SimulationCraft 902-01

for World of Warcraft 9.0.2.36599 Live (wow build level 36599)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Pelagos : 9561 dps, 5172 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9560.9 9560.9 15.7 / 0.164% 751.0 / 7.9% 20.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
407.8 405.1 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 9561
Cataclysm 783 8.2% 9.7 32.36sec 24178 14228 Direct 29.2 6773 13533 8060 19.0%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.72 29.17 0.00 0.00 1.6993 0.0000 235120.39 235120.39 0.00% 14228.16 14228.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.97% 23.62 14 34 6772.83 6141 8265 6771.71 6526 7139 159970 159970 0.00%
crit 19.03% 5.55 0 15 13533.00 12283 16527 13447.27 0 15502 75150 75150 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.78
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1040) 0.0% (10.9%) 12.0 26.03sec 26092 9631

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.96 0.00 178.74 0.00 2.7091 0.1644 0.00 0.00 0.00% 9631.32 9631.32

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.96
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1040 10.9% 0.0 0.00sec 0 0 Direct 536.2 487 975 582 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 536.23 0.00 0.00 0.0000 0.0000 312054.89 312054.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 432.51 313 587 487.44 263 1111 487.90 461 528 210878 210878 0.00%
crit 19.34% 103.71 57 147 975.39 525 2222 975.67 854 1111 101177 101177 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1173 (1560) 12.3% (16.3%) 18.7 15.62sec 25017 12585 Direct 37.2 (73.4) 0 9461 9461 100.0% (60.3%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.68 37.18 0.00 0.00 1.9878 0.0000 351672.33 351672.33 0.00% 12585.29 12585.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.18 26 50 9460.86 5863 13934 9461.37 9002 9872 351672 351672 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.79
  • if_expr:cast_time<havoc_remains
    Internal Combustion 386 4.0% 36.2 15.66sec 3198 0 Direct 36.2 2678 5358 3200 19.5%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.20 36.19 0.00 0.00 0.0000 0.0000 115757.87 115757.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 29.15 17 42 2677.75 1 4228 2680.45 2375 2992 78016 78016 0.00%
crit 19.46% 7.04 1 15 5358.47 12 8458 5367.54 2403 8360 37742 37742 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 823 8.6% 36.9 7.97sec 6696 5359 Direct 55.0 3758 7564 4496 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.90 54.98 0.00 0.00 1.2496 0.0000 247079.76 247079.76 0.00% 5358.95 5358.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 44.34 28 59 3757.89 2047 5739 3757.87 3410 4048 166593 166593 0.00%
crit 19.35% 10.64 2 21 7564.48 4095 11477 7575.85 5159 9575 80486 80486 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.82
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.06
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1648 17.3% 25.4 11.47sec 19460 15453 Direct 31.6 1595 3166 1900 19.3%
Periodic 347.2 1051 2101 1253 19.2% 95.6%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.43 31.63 347.20 347.20 1.2593 2.4829 494854.04 494854.04 0.00% 553.49 15453.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 25.52 15 36 1594.58 819 2296 1595.58 1471 1734 40688 40688 0.00%
crit 19.32% 6.11 1 15 3166.46 1642 4592 3173.36 1920 4451 19355 19355 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.80% 280.52 211 349 1050.54 2 1435 1050.68 1030 1084 294685 294685 0.00%
crit 19.20% 66.68 39 95 2101.00 2 2870 2101.91 2005 2226 140126 140126 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.77
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.77
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 573 6.0% 39.5 7.08sec 4369 3102 Direct 50.4 (50.4) 2877 5720 3419 19.0% (19.0%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.46 50.43 0.00 0.00 1.4085 0.0000 172395.76 172395.76 0.00% 3102.04 3102.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.95% 40.83 23 58 2877.20 1316 3899 2877.32 2643 3135 117427 117427 0.00%
crit 19.05% 9.61 2 20 5720.08 2740 7796 5724.14 3339 6962 54969 54969 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.39
    havoc
    [S]:11.28
  • if_expr:cast_time<havoc_remains
Rain of Fire 1006 10.5% 18.6 15.46sec 16197 13041 Periodic 441.8 572 1145 683 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.62 0.00 0.00 441.81 1.2421 0.0000 301666.47 301666.47 0.00% 13040.53 13040.53
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.72% 356.62 247 488 572.37 507 682 572.44 561 585 204128 204128 0.00%
crit 19.28% 85.19 48 123 1144.98 1013 1364 1145.08 1112 1184 97539 97539 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.50
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:12.12
Scouring Tithe 330 3.5% 13.5 22.72sec 7366 4382 Direct 18.9 1482 2975 1766 18.9%
Periodic 133.7 413 826 493 19.4% 36.4%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.46 18.85 133.67 133.67 1.6811 2.4567 99163.07 99163.07 0.00% 282.50 4381.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.13% 15.29 5 22 1481.71 1004 1674 1482.84 1362 1613 22662 22662 0.00%
crit 18.87% 3.56 0 11 2975.34 2009 3348 2886.15 0 3348 10577 10577 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 107.76 70 147 413.14 123 419 413.12 410 415 44520 44520 0.00%
crit 19.38% 25.91 11 42 826.19 246 837 826.12 800 837 21405 21405 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.76
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.79
Soul Fire 493 5.2% 5.6 49.50sec 26562 7638 Direct 7.5 16490 33010 19859 20.4%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.58 7.46 0.00 0.00 3.4775 0.0000 148132.98 148132.98 0.00% 7638.48 7638.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.56% 5.93 1 11 16490.35 8611 24102 16547.81 12835 19819 97785 97785 0.00%
crit 20.44% 1.52 0 5 33010.01 17213 47906 27117.43 0 46991 50348 50348 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.71
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.94
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.51sec 11976 10360 Direct 6.0 3348 6696 3996 19.2%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23952.04 23952.04 0.00% 10359.88 10359.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 4.85 2 6 3348.13 3348 3348 3348.13 3348 3348 16226 16226 0.00%
crit 19.23% 1.15 0 4 6696.27 6696 6696 4871.97 0 6696 7726 7726 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3513 / 711
Immolation 3247 6.8% 39.0 5.49sec 4996 0 Direct 117.0 1395 2790 1665 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194851.80 194851.80 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 94.33 77 107 1395.06 1395 1395 1395.06 1395 1395 131591 131591 0.00%
crit 19.38% 22.67 10 40 2790.11 2790 2790 2790.11 2790 2790 63260 63260 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15936.93 22764.31 29.99% 270.56 270.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 33.05 25 40 325.55 326 326 325.55 326 326 10758 15367 29.99%
crit 19.40% 7.95 1 16 651.10 651 651 651.10 651 651 5179 7397 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.4% 93.4 3.22sec 1652 1134 Direct 92.7 1395 2790 1665 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.42 92.71 0.00 0.00 1.4561 0.0000 154312.45 154312.45 0.00% 1134.40 1134.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 74.81 53 96 1395.06 1395 1395 1395.06 1395 1395 104368 104368 0.00%
crit 19.31% 17.90 7 32 2790.11 2790 2790 2790.11 2790 2790 49945 49945 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.87
Simple Action Stats Execute Interval
Kyrian_Pelagos
Havoc 9.7 32.16sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.67 0.00 0.00 0.00 1.2444 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.67
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.9 0.0 8.0sec 8.0sec 4.5sec 55.14% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:55.14%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combat Meditation 4.8 0.0 67.6sec 67.6sec 18.4sec 29.49% 0.00% 27.9 (27.9) 4.5

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:350.00

Trigger Details

  • interval_min/max:60.0s / 83.0s
  • trigger_min/max:60.0s / 83.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.0s

Stack Uptimes

  • combat_meditation_1:29.49%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.95% 7.42% 14.11% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
soul_fire Soul Shard 6.59 6.99 7.40% 1.06 0.52 6.90%
immolate Soul Shard 347.19 33.43 35.38% 0.10 1.29 3.71%
incinerate Soul Shard 39.46 10.10 10.69% 0.26 0.04 0.37%
conflagrate Soul Shard 36.88 27.47 29.07% 0.74 0.00 0.00%
mana_regen Mana 662.06 121704.28 100.00% 183.83 28193.72 18.81%
immolate_crits Soul Shard 33.43 3.22 3.41% 0.10 0.12 3.66%
incinerate_crits Soul Shard 9.61 0.96 1.01% 0.10 0.00 0.20%
infernal Soul Shard 120.00 10.30 10.91% 0.09 1.70 14.13%
souring_tithe Soul Shard 1.01 2.02 2.14% 2.00 3.02 59.96%
pet - imp
energy_regen Energy 361.58 3565.87 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 405.09 407.82 28206.4 49179.7 47635.0 50000.0
Soul Shard 4.0 0.31 0.31 6.6 4.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
cataclysm Mana 9.7 4865.6 500.0 500.4 48.3
channel_demonfire Mana 12.0 8970.7 750.0 750.1 34.8
chaos_bolt Soul Shard 18.7 37.4 2.0 2.0 12514.9
conflagrate Mana 36.9 18442.2 500.0 499.8 13.4
havoc Mana 9.7 9670.3 1000.0 1000.0 0.0
immolate Mana 25.4 19068.8 750.0 749.9 26.0
incinerate Mana 39.5 39460.9 1000.0 1000.1 4.4
rain_of_fire Soul Shard 18.6 55.8 3.0 3.0 5402.6
scouring_tithe Mana 13.5 13462.5 1000.0 1000.0 7.4
soul_fire Mana 6.6 6585.9 1000.0 1180.9 22.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.4 3736.5 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Kyrian_Pelagos Damage Per Second
Count 624
Mean 9560.90
Minimum 9040.50
Maximum 10211.59
Spread ( max - min ) 1171.09
Range [ ( max - min ) / 2 * 100% ] 6.12%
Standard Deviation 200.3315
5th Percentile 9252.06
95th Percentile 9895.80
( 95th Percentile - 5th Percentile ) 643.75
Mean Distribution
Standard Deviation 8.0197
95.00% Confidence Interval ( 9545.18 - 9576.62 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1687
0.1 Scale Factor Error with Delta=300 343
0.05 Scale Factor Error with Delta=300 1371
0.01 Scale Factor Error with Delta=300 34260
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 624
Mean 5172.09
Minimum 4840.11
Maximum 5581.41
Spread ( max - min ) 741.30
Range [ ( max - min ) / 2 * 100% ] 7.17%
Standard Deviation 122.9398
5th Percentile 4981.98
95th Percentile 5374.98
( 95th Percentile - 5th Percentile ) 393.00
Mean Distribution
Standard Deviation 4.9215
95.00% Confidence Interval ( 5162.44 - 5181.74 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2171
0.1 Scale Factor Error with Delta=300 130
0.05 Scale Factor Error with Delta=300 517
0.01 Scale Factor Error with Delta=300 12903
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 624
Mean 9560.90
Minimum 9040.50
Maximum 10211.59
Spread ( max - min ) 1171.09
Range [ ( max - min ) / 2 * 100% ] 6.12%
Damage
Kyrian_Pelagos Damage
Count 624
Mean 2501849.60
Minimum 1986473.41
Maximum 3028694.16
Spread ( max - min ) 1042220.75
Range [ ( max - min ) / 2 * 100% ] 20.83%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.71 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.78 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.50 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.96 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.77 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.67 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 12.12 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.82 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.76 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.39 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.06 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.94 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.79 scouring_tithe
Q 7.77 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.79 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.28 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFELDFFJKDLJLJADLEHNRSRONFFIKELJLJAILHNRSPQSNEIFLJLLIL9AHNPRNRSQEFIJFLJKLLILAHNRSSNQP9EFIJLIJLLLAHNPRRSNQEFLFMDJKLD9AHNRNRRNPDFEFFJLLIJLLAHPNRRQSN9EFIJKFLIJAHSSRSNQPEILFJLJILLL9AEHNPRNRQNILLFL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.988 cds M summon_infernal Fluffy_Pillow 49744.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.994 aoe H havoc enemy2 49247.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.999 havoc P scouring_tithe Fluffy_Pillow 48749.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.341 havoc R chaos_bolt Fluffy_Pillow 48420.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust, combat_meditation
0:09.350 havoc N conflagrate Fluffy_Pillow 49425.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, combat_meditation
0:10.357 havoc R chaos_bolt Fluffy_Pillow 49428.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, combat_meditation
0:11.762 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, combat_meditation
0:12.771 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, combat_meditation
0:13.776 havoc R chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
4.7/5: 94% soul_shard
bloodlust, backdraft, combat_meditation
0:15.184 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, combat_meditation
0:16.190 aoe D rain_of_fire Fluffy_Pillow 49958.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, combat_meditation
0:17.196 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft, combat_meditation
0:18.202 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
bloodlust, backdraft, combat_meditation
0:20.684 aoe L incinerate Fluffy_Pillow 49743.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, backdraft, combat_meditation
0:21.622 aoe D rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
3.4/5: 68% soul_shard
bloodlust, combat_meditation
0:22.630 aoe F immolate enemy2 49505.5/50000: 99% mana
1.0/5: 20% soul_shard
bloodlust, combat_meditation
0:23.637 aoe F immolate Fluffy_Pillow 49252.5/50000: 99% mana
1.2/5: 24% soul_shard
bloodlust, combat_meditation
0:24.643 aoe J conflagrate Fluffy_Pillow 49005.5/50000: 98% mana
1.8/5: 36% soul_shard
bloodlust, combat_meditation
0:25.648 aoe K scouring_tithe Fluffy_Pillow 49008.0/50000: 98% mana
2.5/5: 50% soul_shard
bloodlust, backdraft, combat_meditation
0:26.990 aoe D rain_of_fire Fluffy_Pillow 48679.0/50000: 97% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:27.996 aoe L incinerate Fluffy_Pillow 49182.0/50000: 98% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:28.935 aoe J conflagrate Fluffy_Pillow 48651.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:29.942 aoe L incinerate Fluffy_Pillow 48655.0/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:30.883 aoe J conflagrate Fluffy_Pillow 48125.5/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust
0:31.889 default A cataclysm Fluffy_Pillow 48128.5/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:33.228 aoe D rain_of_fire Fluffy_Pillow 48298.0/50000: 97% mana
3.6/5: 72% soul_shard
bloodlust, backdraft
0:34.235 aoe L incinerate Fluffy_Pillow 48801.5/50000: 98% mana
1.1/5: 22% soul_shard
bloodlust, backdraft
0:35.175 aoe E channel_demonfire Fluffy_Pillow 48271.5/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust
0:37.462 aoe H havoc enemy2 48665.0/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust
0:38.469 havoc N conflagrate Fluffy_Pillow 48168.5/50000: 96% mana
2.0/5: 40% soul_shard
bloodlust
0:39.473 havoc R chaos_bolt Fluffy_Pillow 48170.5/50000: 96% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:40.878 havoc S incinerate Fluffy_Pillow 48873.0/50000: 98% mana
1.3/5: 26% soul_shard
bloodlust
0:42.220 havoc R chaos_bolt Fluffy_Pillow 48544.0/50000: 97% mana
2.0/5: 40% soul_shard
0:44.830 havoc O soul_fire Fluffy_Pillow 49849.0/50000: 100% mana
0.4/5: 8% soul_shard
0:48.477 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
0:49.783 aoe F immolate Fluffy_Pillow 49155.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
0:51.090 aoe F immolate enemy3 49058.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
0:52.394 aoe I rain_of_fire Fluffy_Pillow 48960.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
0:53.699 aoe K scouring_tithe Fluffy_Pillow 49613.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
0:55.438 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
0:58.251 aoe L incinerate Fluffy_Pillow 49658.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
0:59.469 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.8/5: 36% soul_shard
1:00.776 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:01.995 aoe J conflagrate Fluffy_Pillow 48764.5/50000: 98% mana
2.8/5: 56% soul_shard
1:03.302 default A cataclysm Fluffy_Pillow 48918.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
1:05.042 aoe I rain_of_fire Fluffy_Pillow 49288.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
1:06.349 aoe L incinerate Fluffy_Pillow 49941.5/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
1:07.569 aoe H havoc enemy2 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
1:08.874 havoc N conflagrate Fluffy_Pillow 48655.0/50000: 97% mana
1.4/5: 28% soul_shard
1:10.354 havoc R chaos_bolt Fluffy_Pillow 48895.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
1:12.183 havoc S incinerate Fluffy_Pillow 49809.5/50000: 100% mana
0.8/5: 16% soul_shard
1:13.923 havoc P scouring_tithe Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
1:15.663 havoc Q immolate Fluffy_Pillow 48872.0/50000: 98% mana
1.5/5: 30% soul_shard
combat_meditation
1:16.970 havoc S incinerate Fluffy_Pillow 48775.5/50000: 98% mana
1.9/5: 38% soul_shard
combat_meditation
1:18.710 havoc N conflagrate Fluffy_Pillow 48645.5/50000: 97% mana
2.4/5: 48% soul_shard
combat_meditation
1:20.016 aoe E channel_demonfire Fluffy_Pillow 48798.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, combat_meditation
1:22.863 aoe I rain_of_fire Fluffy_Pillow 49472.0/50000: 99% mana
4.0/5: 80% soul_shard
backdraft, combat_meditation
1:24.170 aoe F immolate enemy3 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft, combat_meditation
1:25.478 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft, combat_meditation
1:26.698 aoe J conflagrate Fluffy_Pillow 48863.0/50000: 98% mana
1.8/5: 36% soul_shard
combat_meditation
1:28.004 aoe L incinerate Fluffy_Pillow 49016.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, combat_meditation
1:29.223 aoe L incinerate Fluffy_Pillow 48625.5/50000: 97% mana
2.8/5: 56% soul_shard
combat_meditation
1:30.963 aoe I rain_of_fire Fluffy_Pillow 48495.5/50000: 97% mana
3.0/5: 60% soul_shard
combat_meditation
1:32.269 aoe L incinerate Fluffy_Pillow 49148.5/50000: 98% mana
0.3/5: 6% soul_shard
combat_meditation
1:34.009 default 9 soul_fire Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
combat_meditation
1:37.487 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
1:39.228 aoe H havoc enemy2 49373.0/50000: 99% mana
2.4/5: 48% soul_shard
1:40.535 havoc N conflagrate Fluffy_Pillow 49026.5/50000: 98% mana
2.5/5: 50% soul_shard
1:41.842 havoc P scouring_tithe Fluffy_Pillow 49180.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
1:43.581 havoc R chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
1:45.408 havoc N conflagrate Fluffy_Pillow 49915.0/50000: 100% mana
2.4/5: 48% soul_shard
1:46.714 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:48.541 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
1:50.281 havoc Q immolate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
1:51.587 aoe E channel_demonfire Fluffy_Pillow 48905.0/50000: 98% mana
2.5/5: 50% soul_shard
1:54.314 aoe F immolate enemy2 49518.5/50000: 99% mana
2.7/5: 54% soul_shard
1:55.622 aoe I rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
3.0/5: 60% soul_shard
1:56.930 aoe J conflagrate Fluffy_Pillow 49907.0/50000: 100% mana
0.0/5: 0% soul_shard
1:58.236 aoe F immolate enemy3 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
1:59.543 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
2:00.763 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
1.3/5: 26% soul_shard
2:02.247 aoe K scouring_tithe Fluffy_Pillow 49104.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
2:03.988 aoe L incinerate Fluffy_Pillow 48975.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:05.208 aoe L incinerate Fluffy_Pillow 48585.0/50000: 97% mana
2.7/5: 54% soul_shard
2:06.950 aoe I rain_of_fire Fluffy_Pillow 48456.0/50000: 97% mana
3.1/5: 62% soul_shard
2:08.257 aoe L incinerate Fluffy_Pillow 49109.5/50000: 98% mana
0.2/5: 4% soul_shard
2:09.996 default A cataclysm Fluffy_Pillow 48979.0/50000: 98% mana
0.6/5: 12% soul_shard
2:11.735 aoe H havoc enemy2 49348.5/50000: 99% mana
1.0/5: 20% soul_shard
2:13.041 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
2:14.347 havoc R chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:16.176 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
2:17.916 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
2:19.655 havoc N conflagrate Fluffy_Pillow 48871.5/50000: 98% mana
1.8/5: 36% soul_shard
2:20.961 havoc Q immolate Fluffy_Pillow 49024.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:22.269 havoc P scouring_tithe Fluffy_Pillow 48928.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
2:24.011 default 9 soul_fire Fluffy_Pillow 48799.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, combat_meditation
2:27.489 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.9/5: 98% soul_shard
backdraft, combat_meditation
2:30.277 aoe F immolate enemy3 49646.5/50000: 99% mana
5.0/5: 100% soul_shard
combat_meditation
2:31.584 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
combat_meditation
2:32.890 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
2.3/5: 46% soul_shard
combat_meditation
2:34.197 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, combat_meditation
2:35.417 aoe I rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
combat_meditation
2:36.723 aoe J conflagrate Fluffy_Pillow 49655.5/50000: 99% mana
0.4/5: 8% soul_shard
combat_meditation
2:38.030 aoe L incinerate Fluffy_Pillow 49809.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft, combat_meditation
2:39.249 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
combat_meditation
2:40.990 aoe L incinerate Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
combat_meditation
2:42.730 default A cataclysm Fluffy_Pillow 48742.5/50000: 97% mana
2.3/5: 46% soul_shard
combat_meditation
2:44.470 aoe H havoc enemy2 49112.5/50000: 98% mana
2.5/5: 50% soul_shard
2:45.778 havoc N conflagrate Fluffy_Pillow 48766.5/50000: 98% mana
2.7/5: 54% soul_shard
2:47.083 havoc P scouring_tithe Fluffy_Pillow 48919.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
2:48.824 havoc R chaos_bolt Fluffy_Pillow 48789.5/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
2:50.651 havoc R chaos_bolt Fluffy_Pillow 49703.0/50000: 99% mana
2.3/5: 46% soul_shard
2:53.261 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:55.003 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
2:56.309 havoc Q immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:57.615 aoe E channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
3:00.470 aoe F immolate enemy2 49736.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
3:01.777 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
3:02.996 aoe F immolate enemy3 48862.0/50000: 98% mana
3.2/5: 64% soul_shard
3:04.304 cds M summon_infernal Fluffy_Pillow 48766.0/50000: 98% mana
3.3/5: 66% soul_shard
3:05.610 aoe D rain_of_fire Fluffy_Pillow 48419.0/50000: 97% mana
3.7/5: 74% soul_shard
3:06.917 aoe J conflagrate Fluffy_Pillow 49072.5/50000: 98% mana
1.1/5: 22% soul_shard
3:08.223 aoe K scouring_tithe Fluffy_Pillow 49225.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
3:09.963 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
3:11.183 aoe D rain_of_fire Fluffy_Pillow 48612.0/50000: 97% mana
3.1/5: 62% soul_shard
3:12.492 default 9 soul_fire Fluffy_Pillow 49266.5/50000: 99% mana
0.6/5: 12% soul_shard
3:15.969 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.8/5: 56% soul_shard
3:17.708 aoe H havoc enemy2 49371.5/50000: 99% mana
3.2/5: 64% soul_shard
3:19.016 havoc N conflagrate Fluffy_Pillow 49025.5/50000: 98% mana
3.6/5: 72% soul_shard
3:20.321 havoc R chaos_bolt Fluffy_Pillow 49178.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:22.148 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:23.456 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
3:25.283 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.894 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
3:29.201 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
3:30.942 aoe D rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.8/5: 76% soul_shard
backdraft, combat_meditation
3:32.250 aoe F immolate Fluffy_Pillow 49656.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft, combat_meditation
3:33.556 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft, combat_meditation
3:36.391 aoe F immolate enemy3 49919.5/50000: 100% mana
2.0/5: 40% soul_shard
backdraft, combat_meditation
3:37.697 aoe F immolate enemy2 49252.0/50000: 99% mana
2.0/5: 40% soul_shard
backdraft, combat_meditation
3:39.002 aoe J conflagrate Fluffy_Pillow 49154.5/50000: 98% mana
2.2/5: 44% soul_shard
combat_meditation
3:40.309 aoe L incinerate Fluffy_Pillow 49308.0/50000: 99% mana
2.7/5: 54% soul_shard
backdraft, combat_meditation
3:41.528 aoe L incinerate Fluffy_Pillow 48917.5/50000: 98% mana
3.0/5: 60% soul_shard
combat_meditation
3:43.267 aoe I rain_of_fire Fluffy_Pillow 48787.0/50000: 98% mana
3.4/5: 68% soul_shard
combat_meditation
3:44.573 aoe J conflagrate Fluffy_Pillow 49440.0/50000: 99% mana
0.7/5: 14% soul_shard
combat_meditation
3:46.035 aoe L incinerate Fluffy_Pillow 49671.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft, combat_meditation
3:47.254 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
combat_meditation
3:48.996 default A cataclysm Fluffy_Pillow 48873.0/50000: 98% mana
2.0/5: 40% soul_shard
combat_meditation
3:50.734 aoe H havoc enemy2 49242.0/50000: 98% mana
2.3/5: 46% soul_shard
3:52.043 havoc P scouring_tithe Fluffy_Pillow 48896.5/50000: 98% mana
2.7/5: 54% soul_shard
3:53.784 havoc N conflagrate Fluffy_Pillow 48767.0/50000: 98% mana
2.7/5: 54% soul_shard
3:55.091 havoc R chaos_bolt Fluffy_Pillow 48920.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
3:56.918 havoc R chaos_bolt Fluffy_Pillow 49834.0/50000: 100% mana
2.0/5: 40% soul_shard
3:59.528 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
4:00.834 havoc S incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
4:02.574 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
4:03.880 default 9 soul_fire Fluffy_Pillow 49155.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:07.357 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
4:10.227 aoe F immolate enemy3 49687.0/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
4:11.534 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
4:12.840 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
1.6/5: 32% soul_shard
4:14.146 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft
4:15.888 aoe F immolate enemy2 49003.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:17.195 aoe L incinerate Fluffy_Pillow 48906.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:18.415 aoe I rain_of_fire Fluffy_Pillow 48516.5/50000: 97% mana
3.0/5: 60% soul_shard
4:19.722 aoe J conflagrate Fluffy_Pillow 49170.0/50000: 98% mana
0.0/5: 0% soul_shard
4:21.030 default A cataclysm Fluffy_Pillow 49324.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
4:22.770 aoe H havoc enemy2 49502.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
4:24.077 havoc S incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
4:25.296 havoc S incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.7/5: 34% soul_shard
4:27.036 havoc R chaos_bolt Fluffy_Pillow 48635.0/50000: 97% mana
2.5/5: 50% soul_shard
4:29.644 havoc S incinerate Fluffy_Pillow 49939.0/50000: 100% mana
0.9/5: 18% soul_shard
4:31.385 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
4:32.690 havoc Q immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:33.998 havoc P scouring_tithe Fluffy_Pillow 49059.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:35.738 aoe E channel_demonfire Fluffy_Pillow 48929.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, combat_meditation
4:38.664 aoe I rain_of_fire Fluffy_Pillow 49642.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft, combat_meditation
4:39.970 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, combat_meditation
4:41.191 aoe F immolate enemy3 49003.0/50000: 98% mana
0.9/5: 18% soul_shard
combat_meditation
4:42.497 aoe J conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.3/5: 26% soul_shard
combat_meditation
4:43.804 aoe L incinerate Fluffy_Pillow 49059.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft, combat_meditation
4:45.024 aoe J conflagrate Fluffy_Pillow 48669.5/50000: 97% mana
2.4/5: 48% soul_shard
combat_meditation
4:46.578 aoe I rain_of_fire Fluffy_Pillow 48946.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, combat_meditation
4:47.885 aoe L incinerate Fluffy_Pillow 49600.0/50000: 99% mana
0.2/5: 4% soul_shard
backdraft, combat_meditation
4:49.103 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.5/5: 10% soul_shard
combat_meditation
4:50.844 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
0.9/5: 18% soul_shard
combat_meditation
4:52.584 default 9 soul_fire Fluffy_Pillow 48742.0/50000: 97% mana
1.5/5: 30% soul_shard
combat_meditation
4:56.061 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.9/5: 58% soul_shard
4:57.801 aoe E channel_demonfire Fluffy_Pillow 49372.0/50000: 99% mana
3.5/5: 70% soul_shard
5:00.764 aoe H havoc enemy2 50000.0/50000: 100% mana
3.8/5: 76% soul_shard
5:02.071 havoc N conflagrate Fluffy_Pillow 49653.5/50000: 99% mana
3.8/5: 76% soul_shard
5:03.379 havoc P scouring_tithe Fluffy_Pillow 49807.5/50000: 100% mana
5.0/5: 100% soul_shard
backdraft
5:05.119 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
5:06.946 havoc N conflagrate Fluffy_Pillow 49915.5/50000: 100% mana
3.0/5: 60% soul_shard
5:08.252 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
5:10.078 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
5:11.386 havoc N conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
2.6/5: 52% soul_shard
5:12.694 aoe I rain_of_fire Fluffy_Pillow 49407.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
5:14.001 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
5:15.220 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
5:16.961 aoe F immolate enemy3 48872.5/50000: 98% mana
1.6/5: 32% soul_shard
5:18.268 aoe L incinerate Fluffy_Pillow 48776.0/50000: 98% mana
1.7/5: 34% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_Pelagos"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=328266/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necrolord_Emeni : 9855 dps, 5430 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9854.6 9854.6 16.1 / 0.163% 761.3 / 7.7% 20.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
420.5 417.1 Mana 0.00% 38.0 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 9855
Cataclysm 787 8.0% 9.7 32.51sec 24415 14369 Direct 29.0 6817 13642 8135 19.4%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 29.05 0.00 0.00 1.6992 0.0000 236403.68 236403.68 0.00% 14369.30 14369.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 23.42 14 33 6817.42 6141 8349 6816.69 6457 7163 159686 159686 0.00%
crit 19.36% 5.62 1 13 13641.93 12286 16694 13637.55 12416 15406 76717 76717 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.74
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1045) 0.0% (10.6%) 12.1 25.79sec 25850 9621

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.12 0.00 181.06 0.00 2.6869 0.1631 0.00 0.00 0.00% 9620.92 9620.92

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.12
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1045 10.6% 0.0 0.00sec 0 0 Direct 543.2 484 964 577 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 543.17 0.00 0.00 0.0000 0.0000 313391.97 313391.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 437.76 317 589 483.63 263 1122 483.92 454 514 211732 211732 0.00%
crit 19.41% 105.41 64 153 964.24 525 2245 965.03 844 1109 101660 101660 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1201 (1595) 12.2% (16.2%) 19.2 15.09sec 24955 12402 Direct 38.1 (75.3) 0 9456 9456 100.0% (60.2%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.17 38.07 0.00 0.00 2.0122 0.0000 360040.06 360040.06 0.00% 12401.87 12401.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 38.07 28 50 9456.35 5874 14075 9458.09 9107 9749 360040 360040 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:19.26
  • if_expr:cast_time<havoc_remains
    Internal Combustion 394 4.0% 37.3 15.17sec 3174 0 Direct 37.3 2653 5331 3174 19.5%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.25 37.25 0.00 0.00 0.0000 0.0000 118262.92 118262.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.53% 30.00 15 44 2653.11 1 4271 2654.73 2425 2968 79605 79605 0.00%
crit 19.47% 7.25 0 19 5331.10 2 8540 5327.63 0 7220 38658 38658 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 826 8.4% 36.8 7.97sec 6729 5385 Direct 55.3 3747 7478 4480 19.6%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.83 55.31 0.00 0.00 1.2495 0.0000 247827.85 247827.85 0.00% 5385.22 5385.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.36% 44.44 27 59 3747.40 2047 5797 3745.89 3405 4000 166508 166508 0.00%
crit 19.64% 10.86 2 22 7478.03 4096 11595 7464.14 5157 9501 81320 81320 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:18.34
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.48
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (188) 0.0% (1.9%) 6.4 49.23sec 8806 4198

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.43 0.00 0.00 0.00 2.0975 0.0000 0.00 0.00 0.00% 4198.37 4198.37

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:3.04
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    havoc
    [P]:3.44
  • if_expr:cast_time<havoc_remains&soulbind.lead_by_example.enabled
    Decimating Bolt (_tick_t) 188 1.9% 0.0 0.00sec 0 0 Direct 39.2 1212 2420 1443 19.0%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 39.22 0.00 0.00 0.0000 0.0000 56589.78 56589.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.97% 31.76 17 45 1212.44 592 1925 1211.52 1047 1329 38527 38527 0.00%
crit 19.03% 7.46 1 15 2420.03 1185 3850 2415.52 1539 3264 18063 18063 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1643 16.7% 26.0 10.89sec 19009 15083 Direct 32.4 1544 3111 1846 19.3%
Periodic 349.3 1042 2081 1241 19.2% 96.3%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.96 32.40 349.28 349.28 1.2603 2.4841 493433.17 493433.17 0.00% 548.03 15083.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 26.15 15 37 1544.21 819 2319 1544.21 1415 1672 40388 40388 0.00%
crit 19.30% 6.25 0 17 3111.28 1638 4629 3097.02 0 4149 19459 19459 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.80% 282.21 202 354 1041.63 0 1449 1041.73 1025 1065 293965 293965 0.00%
crit 19.20% 67.07 34 99 2081.24 22 2899 2081.89 1968 2194 139621 139621 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.19
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.88
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 933 9.5% 43.4 6.47sec 6465 4480 Direct 54.3 (54.3) 4342 8664 5166 19.1% (19.1%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.41 54.33 0.00 0.00 1.4429 0.0000 280615.37 280615.37 0.00% 4480.17 4480.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.94% 43.98 29 64 4342.17 1391 10144 4349.34 3772 4950 190985 190985 0.00%
crit 19.06% 10.35 2 18 8664.42 2783 20166 8693.66 4938 13254 89630 89630 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:32.36
    havoc
    [S]:11.26
  • if_expr:cast_time<havoc_remains
Rain of Fire 989 10.0% 18.6 15.82sec 15966 12856 Periodic 440.9 564 1129 673 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.59 0.00 0.00 440.92 1.2419 0.0000 296752.76 296752.76 0.00% 12855.90 12855.90
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.78% 356.18 246 488 564.45 507 689 564.37 554 576 201048 201048 0.00%
crit 19.22% 84.73 54 129 1129.44 1013 1378 1129.29 1099 1167 95705 95705 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.44
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:12.13
Soul Fire 503 5.1% 5.6 49.47sec 26957 7752 Direct 7.9 15962 31621 19105 20.1%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.61 7.92 0.00 0.00 3.4775 0.0000 151160.06 151160.06 0.00% 7752.20 7752.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.92% 6.33 2 11 15961.87 8598 21169 16002.46 12979 19292 100914 100914 0.00%
crit 20.08% 1.59 0 5 31621.20 17237 42353 26192.51 0 42107 50246 50246 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.31
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.37
  • if_expr:cast_time<havoc_remains
Summon Infernal 80 0.8% 2.0 180.42sec 11893 10288 Direct 6.0 3348 6696 3958 18.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23785.71 23785.71 0.00% 10287.94 10287.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.60% 4.90 2 6 3348.13 3348 3348 3348.13 3348 3348 16392 16392 0.00%
crit 18.40% 1.10 0 4 6696.27 6696 6696 4775.38 0 6696 7394 7394 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3654 / 739
Immolation 3379 6.9% 39.0 5.49sec 5199 0 Direct 117.0 1450 2901 1733 19.5%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 202749.02 202749.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.51% 94.20 80 106 1450.03 1395 1604 1450.00 1426 1465 136585 136585 0.00%
crit 19.49% 22.80 11 37 2901.21 2790 3208 2901.00 2790 3041 66164 66164 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 275 0.6% 41.0 5.25sec 403 280 Direct 41.0 338 675 403 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16522.02 23600.06 29.99% 280.49 280.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 33.08 24 40 337.80 326 374 337.80 331 343 11176 15964 29.99%
crit 19.31% 7.92 1 17 675.42 651 749 675.45 651 749 5346 7636 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 525 / 525
Firebolt 525 5.3% 93.4 3.22sec 1688 1159 Direct 92.7 1426 2854 1701 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.42 92.71 0.00 0.00 1.4561 0.0000 157663.78 157663.78 0.00% 1159.05 1159.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 74.91 48 94 1426.40 1395 1604 1426.43 1410 1437 106855 106855 0.00%
crit 19.20% 17.80 6 31 2853.91 2790 3208 2854.46 2790 2980 50809 50809 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.87
Simple Action Stats Execute Interval
Necrolord_Emeni
Havoc 9.7 32.21sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 0.00 0.00 0.00 1.2444 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.65
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 8.0sec 8.0sec 4.2sec 51.19% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 25.1s
  • trigger_min/max:1.9s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:51.19%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 6.4 3.4 49.3sec 30.2sec 15.0sec 31.93% 0.00% 3.4 (10.2) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 60.7s
  • trigger_min/max:0.0s / 60.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 27.7s

Stack Uptimes

  • decimating_bolt_1:8.27%
  • decimating_bolt_2:9.16%
  • decimating_bolt_3:14.49%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Lead by Example 6.4 0.0 49.3sec 49.3sec 7.4sec 15.82% 0.00% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:7.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 60.7s
  • trigger_min/max:47.2s / 60.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 7.5s

Stack Uptimes

  • lead_by_example_1:15.82%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.1s
  • trigger_min/max:180.0s / 182.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.1s
  • trigger_min/max:180.0s / 182.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 8.81% 5.76% 12.10% 0.7s 0.0s 5.5s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
soul_fire Soul Shard 6.61 7.32 7.84% 1.11 0.66 8.25%
immolate Soul Shard 349.28 33.36 35.73% 0.10 1.57 4.48%
incinerate Soul Shard 43.42 10.92 11.69% 0.25 0.01 0.07%
conflagrate Soul Shard 36.82 27.65 29.60% 0.75 0.00 0.00%
mana_regen Mana 685.94 125297.72 100.00% 182.67 24615.30 16.42%
immolate_crits Soul Shard 33.75 3.22 3.45% 0.10 0.15 4.45%
incinerate_crits Soul Shard 10.36 1.04 1.11% 0.10 0.00 0.12%
infernal Soul Shard 120.00 9.88 10.58% 0.08 2.12 17.67%
pet - imp
energy_regen Energy 361.58 3565.87 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 417.08 420.53 24617.9 48964.0 46824.0 50000.0
Soul Shard 4.0 0.31 0.31 4.5 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
cataclysm Mana 9.7 4845.3 500.0 500.4 48.8
channel_demonfire Mana 12.1 9093.8 750.0 750.1 34.5
chaos_bolt Soul Shard 19.2 38.3 2.0 2.0 12483.2
conflagrate Mana 36.8 18411.7 500.0 499.9 13.5
decimating_bolt Mana 6.4 12837.5 2000.0 1997.7 4.4
havoc Mana 9.7 9650.0 1000.0 999.9 0.0
immolate Mana 26.0 19463.7 750.0 749.8 25.4
incinerate Mana 43.4 43418.8 1000.0 1000.2 6.5
rain_of_fire Soul Shard 18.6 55.7 3.0 3.0 5326.2
soul_fire Mana 6.6 6614.1 1000.0 1179.5 22.9
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 93.4 3736.5 40.0 40.0 42.2

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Necrolord_Emeni Damage Per Second
Count 624
Mean 9854.61
Minimum 9387.37
Maximum 10372.29
Spread ( max - min ) 984.92
Range [ ( max - min ) / 2 * 100% ] 5.00%
Standard Deviation 205.3089
5th Percentile 9546.49
95th Percentile 10206.10
( 95th Percentile - 5th Percentile ) 659.62
Mean Distribution
Standard Deviation 8.2189
95.00% Confidence Interval ( 9838.50 - 9870.72 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1668
0.1 Scale Factor Error with Delta=300 360
0.05 Scale Factor Error with Delta=300 1440
0.01 Scale Factor Error with Delta=300 35984
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 624
Mean 5430.01
Minimum 5093.84
Maximum 5768.29
Spread ( max - min ) 674.44
Range [ ( max - min ) / 2 * 100% ] 6.21%
Standard Deviation 126.6634
5th Percentile 5232.38
95th Percentile 5649.51
( 95th Percentile - 5th Percentile ) 417.13
Mean Distribution
Standard Deviation 5.0706
95.00% Confidence Interval ( 5420.07 - 5439.95 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2091
0.1 Scale Factor Error with Delta=300 137
0.05 Scale Factor Error with Delta=300 548
0.01 Scale Factor Error with Delta=300 13696
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 624
Mean 9854.61
Minimum 9387.37
Maximum 10372.29
Spread ( max - min ) 984.92
Range [ ( max - min ) / 2 * 100% ] 5.00%
Damage
Necrolord_Emeni Damage
Count 624
Mean 2578263.33
Minimum 2027932.95
Maximum 3193697.89
Spread ( max - min ) 1165764.95
Range [ ( max - min ) / 2 * 100% ] 22.61%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.31 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.74 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.44 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.12 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.19 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.65 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 12.13 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 3.04 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 18.34 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 32.36 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.48 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.37 soul_fire,if=cast_time<havoc_remains
P 3.44 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
Q 7.88 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 19.26 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.26 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFELDFFKLKDLKLADLEHNRSRONFFIJEKLIAKLLHNRSRQSNEFLIKFLL9AHNPRNRQEKILLFLKLFFILAHNRSSNRQ9EFFIJKLKLAHNRRSSNQEFIFLMKDLLK9AHRNPRRNDFEFFLKLLIKLAHRSNQRS9EIFJFKLKLIAHSNRSNRQEFKLFLIKLL9AHNPRRNQEILKFLLL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.082 cds M summon_infernal Fluffy_Pillow 49791.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.089 aoe H havoc enemy2 49294.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.095 havoc P decimating_bolt Fluffy_Pillow 48797.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.768 havoc R chaos_bolt Fluffy_Pillow 47634.0/50000: 95% mana
5.0/5: 100% soul_shard
bloodlust, lead_by_example
0:09.776 havoc N conflagrate Fluffy_Pillow 48638.0/50000: 97% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt(3), lead_by_example
0:10.782 havoc R chaos_bolt Fluffy_Pillow 48641.0/50000: 97% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:12.190 havoc N conflagrate Fluffy_Pillow 49345.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, decimating_bolt(3), lead_by_example
0:13.197 havoc Q immolate Fluffy_Pillow 49348.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:14.203 havoc R chaos_bolt Fluffy_Pillow 49101.5/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:15.609 havoc N conflagrate Fluffy_Pillow 49804.5/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, decimating_bolt(3)
0:16.615 aoe D rain_of_fire Fluffy_Pillow 49807.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:17.623 aoe F immolate enemy3 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:18.631 aoe E channel_demonfire Fluffy_Pillow 49253.0/50000: 99% mana
2.0/5: 40% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:20.797 aoe L incinerate Fluffy_Pillow 49586.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:21.735 aoe D rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
3.4/5: 68% soul_shard
bloodlust, decimating_bolt(2)
0:22.739 aoe F immolate enemy2 49503.5/50000: 99% mana
0.8/5: 16% soul_shard
bloodlust, decimating_bolt(2)
0:23.745 aoe F immolate Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
bloodlust, decimating_bolt(2)
0:24.752 aoe K conflagrate Fluffy_Pillow 49005.5/50000: 98% mana
1.6/5: 32% soul_shard
bloodlust, decimating_bolt(2)
0:25.757 aoe L incinerate Fluffy_Pillow 49008.0/50000: 98% mana
2.4/5: 48% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:26.697 aoe K conflagrate Fluffy_Pillow 48478.0/50000: 97% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt
0:27.704 aoe D rain_of_fire Fluffy_Pillow 48481.5/50000: 97% mana
3.7/5: 74% soul_shard
bloodlust, backdraft, decimating_bolt
0:28.711 aoe L incinerate Fluffy_Pillow 48985.0/50000: 98% mana
1.2/5: 24% soul_shard
bloodlust, backdraft, decimating_bolt
0:29.650 aoe K conflagrate Fluffy_Pillow 48454.5/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust
0:30.742 aoe L incinerate Fluffy_Pillow 48500.5/50000: 97% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:31.681 default A cataclysm Fluffy_Pillow 47970.0/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust
0:33.076 aoe D rain_of_fire Fluffy_Pillow 48167.5/50000: 96% mana
3.7/5: 74% soul_shard
bloodlust
0:34.082 aoe L incinerate Fluffy_Pillow 48670.5/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:35.422 aoe E channel_demonfire Fluffy_Pillow 48340.5/50000: 97% mana
1.5/5: 30% soul_shard
bloodlust
0:37.683 aoe H havoc enemy2 48721.0/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust
0:38.690 havoc N conflagrate Fluffy_Pillow 48224.5/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust
0:39.698 havoc R chaos_bolt Fluffy_Pillow 48228.5/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:41.105 havoc S incinerate Fluffy_Pillow 48932.0/50000: 98% mana
1.6/5: 32% soul_shard
0:42.846 havoc R chaos_bolt Fluffy_Pillow 48802.5/50000: 98% mana
2.3/5: 46% soul_shard
0:45.457 havoc O soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
0:48.935 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
3.0/5: 60% soul_shard
0:50.241 aoe F immolate Fluffy_Pillow 49155.5/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
0:51.548 aoe F immolate enemy3 49059.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
0:52.855 aoe I rain_of_fire Fluffy_Pillow 48962.5/50000: 98% mana
4.2/5: 84% soul_shard
backdraft
0:54.162 aoe J decimating_bolt Fluffy_Pillow 49616.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
0:56.336 aoe E channel_demonfire Fluffy_Pillow 48001.5/50000: 96% mana
1.7/5: 34% soul_shard
backdraft, lead_by_example
0:59.250 aoe K conflagrate Fluffy_Pillow 48708.5/50000: 97% mana
2.0/5: 40% soul_shard
decimating_bolt(3), lead_by_example
1:00.558 aoe L incinerate Fluffy_Pillow 48862.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, decimating_bolt(3), lead_by_example
1:01.777 aoe I rain_of_fire Fluffy_Pillow 48472.0/50000: 97% mana
3.0/5: 60% soul_shard
decimating_bolt(2), lead_by_example
1:03.083 default A cataclysm Fluffy_Pillow 49125.0/50000: 98% mana
0.1/5: 2% soul_shard
decimating_bolt(2), lead_by_example
1:04.824 aoe K conflagrate Fluffy_Pillow 49495.5/50000: 99% mana
0.4/5: 8% soul_shard
decimating_bolt(2)
1:06.131 aoe L incinerate Fluffy_Pillow 49649.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft, decimating_bolt(2)
1:07.351 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
decimating_bolt
1:09.093 aoe H havoc enemy2 48873.5/50000: 98% mana
2.0/5: 40% soul_shard
1:10.400 havoc N conflagrate Fluffy_Pillow 48527.0/50000: 97% mana
2.0/5: 40% soul_shard
1:11.708 havoc R chaos_bolt Fluffy_Pillow 48681.0/50000: 97% mana
3.3/5: 66% soul_shard
backdraft
1:13.536 havoc S incinerate Fluffy_Pillow 49595.0/50000: 99% mana
1.4/5: 28% soul_shard
1:15.279 havoc R chaos_bolt Fluffy_Pillow 49003.5/50000: 98% mana
2.1/5: 42% soul_shard
1:17.888 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
1:19.195 havoc S incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.6/5: 12% soul_shard
1:20.935 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
1:22.242 aoe E channel_demonfire Fluffy_Pillow 49155.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:25.007 aoe F immolate enemy3 49788.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
1:26.310 aoe L incinerate Fluffy_Pillow 49250.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
1:27.531 aoe I rain_of_fire Fluffy_Pillow 48861.0/50000: 98% mana
3.3/5: 66% soul_shard
1:28.837 aoe K conflagrate Fluffy_Pillow 49514.0/50000: 99% mana
0.4/5: 8% soul_shard
1:30.143 aoe F immolate enemy2 49667.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
1:31.451 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
1:32.674 aoe L incinerate Fluffy_Pillow 48864.5/50000: 98% mana
1.7/5: 34% soul_shard
1:34.414 default 9 soul_fire Fluffy_Pillow 48734.5/50000: 97% mana
2.0/5: 40% soul_shard
1:37.892 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.5/5: 70% soul_shard
1:39.634 aoe H havoc enemy2 49373.5/50000: 99% mana
3.6/5: 72% soul_shard
1:40.940 havoc N conflagrate Fluffy_Pillow 49026.5/50000: 98% mana
3.7/5: 74% soul_shard
1:42.247 havoc P decimating_bolt Fluffy_Pillow 49180.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
1:44.423 havoc R chaos_bolt Fluffy_Pillow 48002.5/50000: 96% mana
5.0/5: 100% soul_shard
backdraft, lead_by_example
1:46.248 havoc N conflagrate Fluffy_Pillow 48915.0/50000: 98% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
1:47.556 havoc R chaos_bolt Fluffy_Pillow 49069.0/50000: 98% mana
4.2/5: 84% soul_shard
backdraft, decimating_bolt(3), lead_by_example
1:49.386 havoc Q immolate Fluffy_Pillow 49984.0/50000: 100% mana
2.3/5: 46% soul_shard
decimating_bolt(3), lead_by_example
1:50.692 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
decimating_bolt(3), lead_by_example
1:53.400 aoe K conflagrate Fluffy_Pillow 49856.0/50000: 100% mana
2.9/5: 58% soul_shard
decimating_bolt(3)
1:54.706 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft, decimating_bolt(3)
1:56.012 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, decimating_bolt(3)
1:57.232 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
decimating_bolt(2)
1:58.973 aoe F immolate enemy3 48873.0/50000: 98% mana
1.4/5: 28% soul_shard
decimating_bolt
2:00.281 aoe L incinerate Fluffy_Pillow 48777.0/50000: 98% mana
1.5/5: 30% soul_shard
decimating_bolt
2:02.023 aoe K conflagrate Fluffy_Pillow 48648.0/50000: 97% mana
1.9/5: 38% soul_shard
2:03.329 aoe L incinerate Fluffy_Pillow 48801.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:04.548 aoe F immolate enemy2 48410.5/50000: 97% mana
2.9/5: 58% soul_shard
2:05.853 aoe F immolate Fluffy_Pillow 48313.0/50000: 97% mana
3.1/5: 62% soul_shard
2:07.159 aoe I rain_of_fire Fluffy_Pillow 48216.0/50000: 96% mana
3.2/5: 64% soul_shard
2:08.466 aoe L incinerate Fluffy_Pillow 48869.5/50000: 98% mana
0.4/5: 8% soul_shard
2:10.209 default A cataclysm Fluffy_Pillow 48741.0/50000: 97% mana
0.7/5: 14% soul_shard
2:11.949 aoe H havoc enemy2 49111.0/50000: 98% mana
1.1/5: 22% soul_shard
2:13.255 havoc N conflagrate Fluffy_Pillow 48764.0/50000: 98% mana
1.2/5: 24% soul_shard
2:14.562 havoc R chaos_bolt Fluffy_Pillow 48917.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:16.390 havoc S incinerate Fluffy_Pillow 49831.5/50000: 100% mana
0.7/5: 14% soul_shard
2:18.130 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
2:19.870 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.1/5: 42% soul_shard
2:21.176 havoc R chaos_bolt Fluffy_Pillow 49025.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:23.003 havoc Q immolate Fluffy_Pillow 49938.5/50000: 100% mana
1.4/5: 28% soul_shard
2:24.309 default 9 soul_fire Fluffy_Pillow 49252.0/50000: 99% mana
1.6/5: 32% soul_shard
2:27.787 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
2:30.751 aoe F immolate enemy2 49734.5/50000: 99% mana
3.4/5: 68% soul_shard
2:32.057 aoe F immolate enemy3 49252.0/50000: 99% mana
3.6/5: 72% soul_shard
2:33.364 aoe I rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.6/5: 72% soul_shard
2:34.672 aoe J decimating_bolt Fluffy_Pillow 49809.5/50000: 100% mana
0.9/5: 18% soul_shard
2:36.845 aoe K conflagrate Fluffy_Pillow 48001.0/50000: 96% mana
1.0/5: 20% soul_shard
lead_by_example
2:38.152 aoe L incinerate Fluffy_Pillow 48154.5/50000: 96% mana
1.7/5: 34% soul_shard
backdraft, lead_by_example
2:39.370 aoe K conflagrate Fluffy_Pillow 47763.5/50000: 96% mana
2.0/5: 40% soul_shard
decimating_bolt(2), lead_by_example
2:40.678 aoe L incinerate Fluffy_Pillow 47917.5/50000: 96% mana
2.7/5: 54% soul_shard
backdraft, decimating_bolt(2), lead_by_example
2:41.896 default A cataclysm Fluffy_Pillow 47526.5/50000: 95% mana
3.0/5: 60% soul_shard
decimating_bolt, lead_by_example
2:43.686 aoe H havoc enemy2 47921.5/50000: 96% mana
3.2/5: 64% soul_shard
decimating_bolt, lead_by_example
2:44.992 havoc N conflagrate Fluffy_Pillow 47574.5/50000: 95% mana
3.4/5: 68% soul_shard
decimating_bolt
2:46.299 havoc R chaos_bolt Fluffy_Pillow 47728.0/50000: 95% mana
4.5/5: 90% soul_shard
backdraft, decimating_bolt
2:48.125 havoc R chaos_bolt Fluffy_Pillow 48641.0/50000: 97% mana
2.8/5: 56% soul_shard
decimating_bolt
2:50.735 havoc S incinerate Fluffy_Pillow 49946.0/50000: 100% mana
1.1/5: 22% soul_shard
decimating_bolt
2:52.474 havoc S incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.6/5: 32% soul_shard
2:54.214 havoc N conflagrate Fluffy_Pillow 48871.5/50000: 98% mana
2.3/5: 46% soul_shard
2:55.521 havoc Q immolate Fluffy_Pillow 49025.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
2:56.827 aoe E channel_demonfire Fluffy_Pillow 48928.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
2:59.614 aoe F immolate enemy2 49571.5/50000: 99% mana
4.0/5: 80% soul_shard
backdraft
3:00.919 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
3:02.225 aoe F immolate enemy3 49904.5/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
3:03.531 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
3:04.751 cds M summon_infernal Fluffy_Pillow 48862.0/50000: 98% mana
1.8/5: 36% soul_shard
3:06.057 aoe K conflagrate Fluffy_Pillow 48515.0/50000: 97% mana
2.3/5: 46% soul_shard
3:07.365 aoe D rain_of_fire Fluffy_Pillow 48669.0/50000: 97% mana
3.2/5: 64% soul_shard
backdraft
3:08.672 aoe L incinerate Fluffy_Pillow 49322.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
3:09.891 aoe L incinerate Fluffy_Pillow 48932.0/50000: 98% mana
1.2/5: 24% soul_shard
3:11.632 aoe K conflagrate Fluffy_Pillow 48802.5/50000: 98% mana
2.0/5: 40% soul_shard
3:12.939 default 9 soul_fire Fluffy_Pillow 48956.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:16.417 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:18.158 aoe H havoc enemy2 49373.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
3:19.464 havoc R chaos_bolt Fluffy_Pillow 49026.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:21.291 havoc N conflagrate Fluffy_Pillow 49939.5/50000: 100% mana
3.0/5: 60% soul_shard
3:22.597 havoc P decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:24.773 havoc R chaos_bolt Fluffy_Pillow 48002.5/50000: 96% mana
5.0/5: 100% soul_shard
backdraft, lead_by_example
3:26.602 havoc R chaos_bolt Fluffy_Pillow 48917.0/50000: 98% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
3:29.213 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
decimating_bolt(3), lead_by_example
3:30.518 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft, decimating_bolt(3), lead_by_example
3:31.826 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft, decimating_bolt(3), lead_by_example
3:33.134 aoe E channel_demonfire Fluffy_Pillow 49253.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, decimating_bolt(3)
3:36.085 aoe F immolate enemy2 49978.5/50000: 100% mana
1.4/5: 28% soul_shard
backdraft, decimating_bolt(3)
3:37.393 aoe F immolate enemy3 49253.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, decimating_bolt(3)
3:38.701 aoe L incinerate Fluffy_Pillow 49157.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, decimating_bolt(3)
3:39.920 aoe K conflagrate Fluffy_Pillow 48766.5/50000: 98% mana
1.9/5: 38% soul_shard
decimating_bolt(2)
3:41.225 aoe L incinerate Fluffy_Pillow 48919.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, decimating_bolt(2)
3:42.445 aoe L incinerate Fluffy_Pillow 48529.0/50000: 97% mana
2.9/5: 58% soul_shard
decimating_bolt
3:44.189 aoe I rain_of_fire Fluffy_Pillow 48401.0/50000: 97% mana
3.5/5: 70% soul_shard
3:45.496 aoe K conflagrate Fluffy_Pillow 49054.5/50000: 98% mana
0.7/5: 14% soul_shard
3:46.803 aoe L incinerate Fluffy_Pillow 49208.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
3:48.023 default A cataclysm Fluffy_Pillow 48818.0/50000: 98% mana
1.7/5: 34% soul_shard
3:49.895 aoe H havoc enemy2 49254.0/50000: 99% mana
1.9/5: 38% soul_shard
3:51.201 havoc R chaos_bolt Fluffy_Pillow 48907.0/50000: 98% mana
2.0/5: 40% soul_shard
3:53.811 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
3:55.553 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
3:56.860 havoc Q immolate Fluffy_Pillow 49156.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
3:58.167 havoc R chaos_bolt Fluffy_Pillow 49060.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:59.995 havoc S incinerate Fluffy_Pillow 49974.0/50000: 100% mana
0.7/5: 14% soul_shard
4:01.736 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
4:05.213 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.8/5: 56% soul_shard
4:08.070 aoe I rain_of_fire Fluffy_Pillow 49680.5/50000: 99% mana
3.1/5: 62% soul_shard
4:09.376 aoe F immolate enemy3 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
4:10.683 aoe J decimating_bolt Fluffy_Pillow 49252.5/50000: 99% mana
0.5/5: 10% soul_shard
4:12.857 aoe F immolate enemy2 48001.5/50000: 96% mana
1.0/5: 20% soul_shard
lead_by_example
4:14.163 aoe K conflagrate Fluffy_Pillow 47904.5/50000: 96% mana
1.1/5: 22% soul_shard
lead_by_example
4:15.469 aoe L incinerate Fluffy_Pillow 48057.5/50000: 96% mana
1.8/5: 36% soul_shard
backdraft, decimating_bolt(3), lead_by_example
4:16.690 aoe K conflagrate Fluffy_Pillow 47668.0/50000: 95% mana
2.1/5: 42% soul_shard
decimating_bolt(2), lead_by_example
4:17.997 aoe L incinerate Fluffy_Pillow 47821.5/50000: 96% mana
2.7/5: 54% soul_shard
backdraft, decimating_bolt(2), lead_by_example
4:19.217 aoe I rain_of_fire Fluffy_Pillow 47431.5/50000: 95% mana
3.2/5: 64% soul_shard
decimating_bolt, lead_by_example
4:20.524 default A cataclysm Fluffy_Pillow 48085.0/50000: 96% mana
0.3/5: 6% soul_shard
decimating_bolt
4:22.263 aoe H havoc enemy2 48454.5/50000: 97% mana
0.5/5: 10% soul_shard
decimating_bolt
4:23.570 havoc S incinerate Fluffy_Pillow 48108.0/50000: 96% mana
0.7/5: 14% soul_shard
decimating_bolt
4:25.309 havoc N conflagrate Fluffy_Pillow 47977.5/50000: 96% mana
1.4/5: 28% soul_shard
4:26.618 havoc R chaos_bolt Fluffy_Pillow 48132.0/50000: 96% mana
2.5/5: 50% soul_shard
backdraft
4:28.447 havoc S incinerate Fluffy_Pillow 49046.5/50000: 98% mana
0.8/5: 16% soul_shard
4:30.186 havoc N conflagrate Fluffy_Pillow 48916.0/50000: 98% mana
1.4/5: 28% soul_shard
4:31.494 havoc R chaos_bolt Fluffy_Pillow 49070.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:33.321 havoc Q immolate Fluffy_Pillow 49983.5/50000: 100% mana
0.8/5: 16% soul_shard
4:34.628 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
4:37.541 aoe F immolate enemy2 49959.0/50000: 100% mana
1.4/5: 28% soul_shard
4:38.845 aoe K conflagrate Fluffy_Pillow 49251.0/50000: 99% mana
1.5/5: 30% soul_shard
4:40.151 aoe L incinerate Fluffy_Pillow 49404.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
4:41.371 aoe F immolate enemy3 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
4:42.677 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
2.6/5: 52% soul_shard
4:44.418 aoe I rain_of_fire Fluffy_Pillow 48776.0/50000: 98% mana
3.2/5: 64% soul_shard
4:45.724 aoe K conflagrate Fluffy_Pillow 49429.0/50000: 99% mana
0.2/5: 4% soul_shard
4:47.132 aoe L incinerate Fluffy_Pillow 49633.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
4:48.351 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
4:50.093 default 9 soul_fire Fluffy_Pillow 48873.0/50000: 98% mana
1.8/5: 36% soul_shard
4:53.686 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
3.3/5: 66% soul_shard
4:55.426 aoe H havoc enemy2 49372.0/50000: 99% mana
3.5/5: 70% soul_shard
4:56.733 havoc N conflagrate Fluffy_Pillow 49025.5/50000: 98% mana
3.5/5: 70% soul_shard
4:58.039 havoc P decimating_bolt Fluffy_Pillow 49178.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
5:00.215 havoc R chaos_bolt Fluffy_Pillow 48002.5/50000: 96% mana
5.0/5: 100% soul_shard
backdraft, lead_by_example
5:02.044 havoc R chaos_bolt Fluffy_Pillow 48917.0/50000: 98% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
5:04.654 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
decimating_bolt(3), lead_by_example
5:05.959 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
backdraft, decimating_bolt(3), lead_by_example
5:07.266 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft, decimating_bolt(3), lead_by_example
5:10.146 aoe I rain_of_fire Fluffy_Pillow 49942.5/50000: 100% mana
3.1/5: 62% soul_shard
backdraft, decimating_bolt(3)
5:11.452 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft, decimating_bolt(3)
5:12.672 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
decimating_bolt(2)
5:13.977 aoe F immolate enemy3 49155.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft, decimating_bolt(2)
5:15.283 aoe L incinerate Fluffy_Pillow 49058.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft, decimating_bolt(2)
5:16.503 aoe L incinerate Fluffy_Pillow 48668.0/50000: 97% mana
1.8/5: 36% soul_shard
decimating_bolt
5:18.244 aoe L incinerate Fluffy_Pillow 48538.5/50000: 97% mana
2.2/5: 44% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necrolord_Emeni"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=342156/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Dream : 9708 dps, 5245 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9707.9 9707.9 16.9 / 0.174% 804.9 / 8.3% 21.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.6 386.1 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 9708
Cataclysm 774 8.0% 9.7 32.37sec 23945 14091 Direct 29.1 6700 13400 7983 19.1%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.71 29.13 0.00 0.00 1.6993 0.0000 232504.07 232504.07 0.00% 14091.16 14091.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 23.56 15 32 6699.98 6141 7261 6700.12 6440 6877 157864 157864 0.00%
crit 19.12% 5.57 0 14 13399.94 12283 14521 13341.83 0 14481 74640 74640 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.77
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1023) 0.0% (10.6%) 12.1 25.45sec 25461 9449

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.06 0.00 180.17 0.00 2.6946 0.1635 0.00 0.00 0.00% 9449.11 9449.11

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.06
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1023 10.6% 0.0 0.00sec 0 0 Direct 540.5 476 953 568 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 540.52 0.00 0.00 0.0000 0.0000 307077.15 307077.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 435.74 312 585 475.68 263 976 475.86 445 502 207253 207253 0.00%
crit 19.39% 104.78 68 147 953.20 525 1952 953.30 806 1137 99824 99824 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1303 (1752) 13.4% (18.0%) 21.7 13.51sec 24120 12318 Direct 43.2 (86.1) 0 9031 9031 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.75 43.22 0.00 0.00 1.9581 0.0000 390367.08 390367.08 0.00% 12317.93 12317.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.22 32 58 9031.37 5868 12241 9031.00 8763 9253 390367 390367 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.84
  • if_expr:cast_time<havoc_remains
    Internal Combustion 448 4.6% 42.9 13.49sec 3132 0 Direct 42.9 2622 5277 3133 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.85 42.85 0.00 0.00 0.0000 0.0000 134204.29 134204.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 34.62 21 46 2622.37 1 3715 2623.77 2435 2833 90787 90787 0.00%
crit 19.20% 8.23 2 17 5276.81 210 7428 5269.58 3472 6464 43417 43417 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 808 8.3% 37.0 7.97sec 6554 5241 Direct 56.7 3584 7186 4276 19.2%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.98 56.67 0.00 0.00 1.2507 0.0000 242370.26 242370.26 0.00% 5240.66 5240.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 45.78 33 63 3583.71 2047 5042 3584.56 3309 3819 164070 164070 0.00%
crit 19.23% 10.90 2 24 7186.31 4094 10084 7192.23 5208 8942 78300 78300 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.28
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.69
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1610 16.6% 26.7 10.85sec 18082 14333 Direct 34.0 1528 3052 1823 19.3%
Periodic 347.9 1014 2030 1212 19.4% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.73 33.97 347.85 347.85 1.2616 2.4840 483375.71 483375.71 0.00% 538.41 14332.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 27.40 17 40 1527.89 819 2017 1528.13 1417 1658 41877 41877 0.00%
crit 19.34% 6.57 1 14 3051.90 1638 4033 3052.42 1841 4031 20063 20063 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.57% 280.27 215 348 1014.26 1 1261 1014.28 998 1032 284259 284259 0.00%
crit 19.43% 67.58 41 105 2029.64 7 2521 2030.53 1934 2116 137177 137177 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.97
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.87
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 614 6.3% 44.7 6.13sec 4128 2817 Direct 55.3 (55.3) 2795 5601 3339 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.73 55.29 0.00 0.00 1.4653 0.0000 184636.56 184636.56 0.00% 2816.99 2816.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 44.58 29 65 2795.44 1316 3426 2799.43 2601 3008 124636 124636 0.00%
crit 19.38% 10.72 2 23 5600.77 2650 6852 5607.42 4303 6528 60000 60000 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:34.02
    havoc
    [R]:10.98
  • if_expr:cast_time<havoc_remains
Rain of Fire 909 9.4% 17.4 16.45sec 15650 12552 Periodic 413.7 553 1106 660 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.44 0.00 0.00 413.70 1.2468 0.0000 272894.18 272894.18 0.00% 12552.05 12552.05
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.68% 333.77 208 459 552.77 507 599 552.79 546 561 184502 184502 0.00%
crit 19.32% 79.93 44 117 1106.00 1013 1198 1105.85 1083 1127 88392 88392 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.30
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.15
Soul Fire 511 5.3% 5.6 49.41sec 27479 7902 Direct 7.9 16423 33102 19529 18.6%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.59 7.87 0.00 0.00 3.4775 0.0000 153601.93 153601.93 0.00% 7902.15 7902.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.38% 6.40 2 11 16422.63 8601 21175 16468.07 13628 19756 105164 105164 0.00%
crit 18.62% 1.46 0 6 33101.67 17256 42348 25636.41 0 42273 48438 48438 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.34
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.34
  • if_expr:cast_time<havoc_remains
Soul Rot 339 3.5% 5.3 62.53sec 19329 15469 Periodic 96.7 883 1766 1053 19.3% 13.8%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.27 0.00 96.68 96.68 1.2495 1.2898 101817.15 101817.15 0.00% 775.57 15469.03
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.71% 78.03 51 99 882.80 424 1395 883.01 813 930 68888 68888 0.00%
crit 19.29% 18.65 7 34 1765.63 849 2790 1764.17 1360 2281 32930 32930 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.30
Summon Infernal 81 0.8% 2.0 180.67sec 11957 10344 Direct 6.0 3348 6696 3984 19.0%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23914.48 23914.48 0.00% 10343.63 10343.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.96% 4.86 1 6 3348.13 3348 3348 3348.13 3348 3348 16263 16263 0.00%
crit 19.04% 1.14 0 5 6696.27 6696 6696 4764.65 0 6696 7651 7651 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3825 / 774
Immolation 3560 7.3% 39.0 5.50sec 5477 0 Direct 117.0 1530 3056 1825 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213592.43 213592.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 94.30 79 107 1529.54 1395 2023 1529.53 1496 1557 144239 144239 0.00%
crit 19.40% 22.70 10 38 3055.53 2790 4046 3055.62 2845 3327 69353 69353 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.5% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15936.41 22763.56 29.99% 270.55 270.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 33.05 25 40 325.55 326 326 325.55 326 326 10759 15368 29.99%
crit 19.39% 7.95 1 16 651.10 651 651 651.10 651 651 5178 7396 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.3% 93.4 3.22sec 1652 1134 Direct 92.7 1395 2790 1665 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.42 92.71 0.00 0.00 1.4561 0.0000 154290.09 154290.09 0.00% 1134.24 1134.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 74.83 56 97 1395.06 1395 1395 1395.06 1395 1395 104390 104390 0.00%
crit 19.29% 17.88 8 30 2790.11 2790 2790 2790.11 2790 2790 49900 49900 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.87
Simple Action Stats Execute Interval
NightFae_Dream
Havoc 9.7 32.06sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.67 0.00 0.00 0.00 1.2444 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.68
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 8.0sec 8.0sec 4.1sec 50.26% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.2s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.26%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.86% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.8s
  • trigger_min/max:61.3s / 68.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 8.0s

Stack Uptimes

  • soul_rot_1:13.86%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.0s
  • trigger_min/max:180.0s / 185.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.0s
  • trigger_min/max:180.0s / 185.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.12% 11.34% 18.16% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
soul_fire Soul Shard 6.60 7.24 7.61% 1.10 0.68 8.57%
immolate Soul Shard 347.84 33.61 35.33% 0.10 1.17 3.36%
incinerate Soul Shard 44.75 11.12 11.69% 0.25 0.01 0.08%
conflagrate Soul Shard 36.97 28.33 29.77% 0.77 0.00 0.00%
mana_regen Mana 659.81 115992.98 100.00% 175.80 33911.78 22.62%
immolate_crits Soul Shard 33.66 3.25 3.42% 0.10 0.11 3.31%
incinerate_crits Soul Shard 10.73 1.07 1.13% 0.10 0.00 0.12%
infernal Soul Shard 120.00 10.52 11.05% 0.09 1.48 12.35%
pet - imp
energy_regen Energy 361.58 3565.87 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.07 388.61 33927.2 49235.2 47804.5 50000.0
Soul Shard 4.0 0.32 0.32 3.5 2.3 0.1 5.0
Usage Type Count Total Avg RPE APR
NightFae_Dream
cataclysm Mana 9.7 4858.6 500.0 500.4 47.9
channel_demonfire Mana 12.1 9044.5 750.0 749.9 34.0
chaos_bolt Soul Shard 21.7 43.4 2.0 2.0 12073.9
conflagrate Mana 37.0 18485.2 500.0 499.9 13.1
havoc Mana 9.7 9678.1 1000.0 1000.7 0.0
immolate Mana 26.7 20020.3 750.0 748.9 24.1
incinerate Mana 44.8 44754.7 1000.0 1000.5 4.1
rain_of_fire Soul Shard 17.4 52.3 3.0 3.0 5214.3
soul_fire Mana 6.6 6600.0 1000.0 1180.7 23.3
soul_rot Mana 5.3 1315.2 250.0 249.7 77.4
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.4 3736.5 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Dream Damage Per Second
Count 624
Mean 9707.89
Minimum 9201.89
Maximum 10342.10
Spread ( max - min ) 1140.21
Range [ ( max - min ) / 2 * 100% ] 5.87%
Standard Deviation 214.8726
5th Percentile 9391.16
95th Percentile 10102.58
( 95th Percentile - 5th Percentile ) 711.41
Mean Distribution
Standard Deviation 8.6018
95.00% Confidence Interval ( 9691.03 - 9724.75 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1882
0.1 Scale Factor Error with Delta=300 395
0.05 Scale Factor Error with Delta=300 1577
0.01 Scale Factor Error with Delta=300 39414
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 624
Mean 5244.88
Minimum 4933.51
Maximum 5629.57
Spread ( max - min ) 696.07
Range [ ( max - min ) / 2 * 100% ] 6.64%
Standard Deviation 132.0808
5th Percentile 5042.73
95th Percentile 5478.57
( 95th Percentile - 5th Percentile ) 435.84
Mean Distribution
Standard Deviation 5.2875
95.00% Confidence Interval ( 5234.52 - 5255.24 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2437
0.1 Scale Factor Error with Delta=300 149
0.05 Scale Factor Error with Delta=300 596
0.01 Scale Factor Error with Delta=300 14893
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 624
Mean 9707.89
Minimum 9201.89
Maximum 10342.10
Spread ( max - min ) 1140.21
Range [ ( max - min ) / 2 * 100% ] 5.87%
Damage
NightFae_Dream Damage
Count 624
Mean 2526762.87
Minimum 2014033.54
Maximum 3053925.33
Spread ( max - min ) 1039891.79
Range [ ( max - min ) / 2 * 100% ] 20.58%
DTPS
NightFae_Dream Damage Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.34 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.77 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.30 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.30 soul_rot
F 12.06 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.97 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.68 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.15 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.28 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 34.02 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.69 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.34 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.87 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.84 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.98 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGGDLKLLDKALLJFINQRRNOPGJLKFJLKAELLINQQPNQFGLGGKLLJA9INQNQRRNFGGGJLKLLEAJIRNQRNPRF9GJKLJKLLAIQRNQRPNFLJGKLLMGEDKA9FIQNQNPQDGLKLGFJAKLLLINQPQRNP9FEGGJAKLJIRNQRNPRFGJKLLLKJALLINOQQNFLGGGEJKLL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E soul_rot Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.745 aoe F channel_demonfire Fluffy_Pillow 49622.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.939 cds M summon_infernal Fluffy_Pillow 49969.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:05.946 aoe I havoc enemy2 49473.0/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:06.952 havoc Q chaos_bolt Fluffy_Pillow 48976.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:08.961 havoc N conflagrate Fluffy_Pillow 49980.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:09.969 havoc Q chaos_bolt Fluffy_Pillow 49984.5/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft, soul_rot
0:11.374 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:12.380 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:13.387 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:14.795 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:15.800 havoc Q chaos_bolt Fluffy_Pillow 49959.0/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:17.207 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:18.212 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:19.218 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:21.667 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:22.673 aoe G immolate enemy2 49252.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:23.680 aoe G immolate enemy3 49005.5/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:24.687 aoe D rain_of_fire Fluffy_Pillow 48759.0/50000: 98% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:25.693 aoe L incinerate Fluffy_Pillow 49262.0/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:26.632 aoe K conflagrate Fluffy_Pillow 48731.5/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:27.638 aoe L incinerate Fluffy_Pillow 48734.5/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:28.578 aoe L incinerate Fluffy_Pillow 48204.5/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust
0:29.920 aoe D rain_of_fire Fluffy_Pillow 47875.5/50000: 96% mana
3.4/5: 68% soul_shard
bloodlust
0:30.926 aoe K conflagrate Fluffy_Pillow 48378.5/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust
0:31.933 default A cataclysm Fluffy_Pillow 48382.0/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:33.273 aoe L incinerate Fluffy_Pillow 48552.0/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:34.212 aoe L incinerate Fluffy_Pillow 48021.5/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust
0:35.553 aoe J rain_of_fire Fluffy_Pillow 47692.0/50000: 95% mana
3.1/5: 62% soul_shard
bloodlust
0:36.558 aoe F channel_demonfire Fluffy_Pillow 48194.5/50000: 96% mana
0.4/5: 8% soul_shard
bloodlust
0:38.750 aoe I havoc enemy2 48540.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:39.757 havoc N conflagrate Fluffy_Pillow 48044.0/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust
0:40.765 havoc Q chaos_bolt Fluffy_Pillow 48048.0/50000: 96% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:42.171 havoc R incinerate Fluffy_Pillow 48751.0/50000: 98% mana
0.4/5: 8% soul_shard
0:43.912 havoc R incinerate Fluffy_Pillow 48621.5/50000: 97% mana
0.9/5: 18% soul_shard
0:45.652 havoc N conflagrate Fluffy_Pillow 48491.5/50000: 97% mana
1.7/5: 34% soul_shard
0:46.960 havoc O soul_fire Fluffy_Pillow 48645.5/50000: 97% mana
2.9/5: 58% soul_shard
backdraft
0:50.439 havoc P immolate Fluffy_Pillow 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.745 aoe G immolate enemy3 48906.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:53.053 aoe J rain_of_fire Fluffy_Pillow 48810.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:54.360 aoe L incinerate Fluffy_Pillow 49463.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
0:55.579 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
0:56.885 aoe F channel_demonfire Fluffy_Pillow 49155.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
0:59.709 aoe J rain_of_fire Fluffy_Pillow 49817.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:01.017 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
1:02.236 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
1:03.542 default A cataclysm Fluffy_Pillow 49155.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
1:05.284 aoe E soul_rot Fluffy_Pillow 49503.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
1:06.590 aoe L incinerate Fluffy_Pillow 49752.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft, soul_rot
1:07.810 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.7/5: 54% soul_shard
soul_rot
1:09.551 aoe I havoc enemy2 48873.0/50000: 98% mana
3.0/5: 60% soul_shard
soul_rot
1:10.858 havoc N conflagrate Fluffy_Pillow 48526.5/50000: 97% mana
3.2/5: 64% soul_shard
soul_rot
1:12.165 havoc Q chaos_bolt Fluffy_Pillow 48680.0/50000: 97% mana
4.3/5: 86% soul_shard
backdraft, soul_rot
1:13.993 havoc Q chaos_bolt Fluffy_Pillow 49594.0/50000: 99% mana
2.6/5: 52% soul_shard
soul_rot
1:16.605 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
1:17.911 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.0/5: 20% soul_shard
1:19.218 havoc Q chaos_bolt Fluffy_Pillow 49405.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
1:21.046 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
1:23.918 aoe G immolate enemy3 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:25.224 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.0/5: 20% soul_shard
1:26.964 aoe G immolate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
1:28.269 aoe G immolate enemy2 48904.5/50000: 98% mana
1.7/5: 34% soul_shard
1:29.577 aoe K conflagrate Fluffy_Pillow 48808.5/50000: 98% mana
1.8/5: 36% soul_shard
1:30.884 aoe L incinerate Fluffy_Pillow 48962.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:32.102 aoe L incinerate Fluffy_Pillow 48571.0/50000: 97% mana
2.8/5: 56% soul_shard
1:33.844 aoe J rain_of_fire Fluffy_Pillow 48442.0/50000: 97% mana
3.4/5: 68% soul_shard
1:35.149 default A cataclysm Fluffy_Pillow 49094.5/50000: 98% mana
0.5/5: 10% soul_shard
1:37.019 default 9 soul_fire Fluffy_Pillow 49502.5/50000: 99% mana
0.7/5: 14% soul_shard
1:40.498 aoe I havoc enemy2 49003.0/50000: 98% mana
2.1/5: 42% soul_shard
1:41.805 havoc N conflagrate Fluffy_Pillow 48656.5/50000: 97% mana
2.3/5: 46% soul_shard
1:43.111 havoc Q chaos_bolt Fluffy_Pillow 48809.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
1:44.939 havoc N conflagrate Fluffy_Pillow 49723.5/50000: 99% mana
1.6/5: 32% soul_shard
1:46.245 havoc Q chaos_bolt Fluffy_Pillow 49876.5/50000: 100% mana
2.7/5: 54% soul_shard
backdraft
1:48.072 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:49.813 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
1:51.552 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.2/5: 44% soul_shard
1:53.093 aoe F channel_demonfire Fluffy_Pillow 49142.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
1:55.926 aoe G immolate enemy2 49809.0/50000: 100% mana
4.0/5: 80% soul_shard
backdraft
1:57.232 aoe G immolate Fluffy_Pillow 49252.0/50000: 99% mana
4.0/5: 80% soul_shard
backdraft
1:58.538 aoe G immolate enemy3 49155.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
1:59.844 aoe J rain_of_fire Fluffy_Pillow 49058.0/50000: 98% mana
4.2/5: 84% soul_shard
backdraft
2:01.152 aoe L incinerate Fluffy_Pillow 49712.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
2:02.369 aoe K conflagrate Fluffy_Pillow 49001.0/50000: 98% mana
1.7/5: 34% soul_shard
2:03.676 aoe L incinerate Fluffy_Pillow 49154.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:04.895 aoe L incinerate Fluffy_Pillow 48764.0/50000: 98% mana
2.7/5: 54% soul_shard
2:06.636 aoe E soul_rot Fluffy_Pillow 48634.5/50000: 97% mana
3.2/5: 64% soul_shard
2:07.944 default A cataclysm Fluffy_Pillow 49038.5/50000: 98% mana
3.3/5: 66% soul_shard
soul_rot
2:09.685 aoe J rain_of_fire Fluffy_Pillow 49409.0/50000: 99% mana
3.5/5: 70% soul_shard
soul_rot
2:10.990 aoe I havoc enemy2 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
soul_rot
2:12.296 havoc R incinerate Fluffy_Pillow 49653.0/50000: 99% mana
0.8/5: 16% soul_shard
soul_rot
2:14.035 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.6/5: 32% soul_shard
soul_rot
2:15.342 havoc Q chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, soul_rot
2:17.168 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
2:18.909 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
2:20.216 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:21.522 havoc R incinerate Fluffy_Pillow 49059.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:22.743 aoe F channel_demonfire Fluffy_Pillow 48669.5/50000: 97% mana
3.6/5: 72% soul_shard
2:25.530 default 9 soul_fire Fluffy_Pillow 49313.0/50000: 99% mana
3.9/5: 78% soul_shard
2:29.008 aoe G immolate enemy3 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
2:30.314 aoe J rain_of_fire Fluffy_Pillow 48905.5/50000: 98% mana
5.0/5: 100% soul_shard
2:31.620 aoe K conflagrate Fluffy_Pillow 49558.5/50000: 99% mana
2.1/5: 42% soul_shard
2:32.926 aoe L incinerate Fluffy_Pillow 49711.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
2:34.145 aoe J rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.2/5: 64% soul_shard
2:35.450 aoe K conflagrate Fluffy_Pillow 49654.5/50000: 99% mana
0.4/5: 8% soul_shard
2:36.756 aoe L incinerate Fluffy_Pillow 49807.5/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
2:37.975 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
2:39.715 default A cataclysm Fluffy_Pillow 48872.0/50000: 98% mana
1.9/5: 38% soul_shard
2:41.455 aoe I havoc enemy2 49242.0/50000: 98% mana
2.1/5: 42% soul_shard
2:42.763 havoc Q chaos_bolt Fluffy_Pillow 48896.0/50000: 98% mana
2.3/5: 46% soul_shard
2:45.372 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:47.112 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:48.419 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:50.247 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:51.989 havoc P immolate Fluffy_Pillow 49003.0/50000: 98% mana
1.3/5: 26% soul_shard
2:53.295 havoc N conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.6/5: 32% soul_shard
2:54.600 aoe F channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:57.413 aoe L incinerate Fluffy_Pillow 49715.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
2:58.633 aoe J rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.5/5: 70% soul_shard
2:59.940 aoe G immolate enemy3 49656.0/50000: 99% mana
0.5/5: 10% soul_shard
3:01.247 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
3:02.553 aoe L incinerate Fluffy_Pillow 49405.5/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
3:03.772 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
3:05.512 cds M summon_infernal Fluffy_Pillow 48872.0/50000: 98% mana
2.0/5: 40% soul_shard
3:06.819 aoe G immolate enemy2 48525.5/50000: 97% mana
2.5/5: 50% soul_shard
3:08.125 aoe E soul_rot Fluffy_Pillow 48428.5/50000: 97% mana
2.8/5: 56% soul_shard
3:09.432 aoe D rain_of_fire Fluffy_Pillow 48832.0/50000: 98% mana
3.4/5: 68% soul_shard
soul_rot
3:10.739 aoe K conflagrate Fluffy_Pillow 49485.5/50000: 99% mana
0.7/5: 14% soul_shard
soul_rot
3:12.047 default A cataclysm Fluffy_Pillow 49639.5/50000: 99% mana
1.8/5: 36% soul_shard
backdraft, soul_rot
3:13.788 default 9 soul_fire Fluffy_Pillow 49502.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, soul_rot
3:17.480 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.4/5: 88% soul_shard
backdraft
3:20.292 aoe I havoc enemy2 49658.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
3:21.598 havoc Q chaos_bolt Fluffy_Pillow 49311.0/50000: 99% mana
5.0/5: 100% soul_shard
3:24.209 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.516 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:27.344 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:28.651 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:29.957 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
3:31.784 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:33.089 aoe G immolate enemy3 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
3:34.396 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
3:36.137 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
3:37.443 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:38.663 aoe G immolate enemy2 48765.5/50000: 98% mana
2.7/5: 54% soul_shard
3:39.969 aoe F channel_demonfire Fluffy_Pillow 48668.5/50000: 97% mana
2.9/5: 58% soul_shard
3:42.720 aoe J rain_of_fire Fluffy_Pillow 49294.0/50000: 99% mana
3.3/5: 66% soul_shard
3:44.027 default A cataclysm Fluffy_Pillow 49947.5/50000: 100% mana
0.4/5: 8% soul_shard
3:45.766 aoe K conflagrate Fluffy_Pillow 49501.5/50000: 99% mana
0.8/5: 16% soul_shard
3:47.073 aoe L incinerate Fluffy_Pillow 49655.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
3:48.293 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
3:50.033 aoe L incinerate Fluffy_Pillow 48872.5/50000: 98% mana
2.0/5: 40% soul_shard
3:51.772 aoe I havoc enemy2 48742.0/50000: 97% mana
2.5/5: 50% soul_shard
3:53.081 havoc N conflagrate Fluffy_Pillow 48396.5/50000: 97% mana
2.7/5: 54% soul_shard
3:54.385 havoc Q chaos_bolt Fluffy_Pillow 48548.5/50000: 97% mana
4.0/5: 80% soul_shard
backdraft
3:56.212 havoc P immolate Fluffy_Pillow 49462.0/50000: 99% mana
2.3/5: 46% soul_shard
3:57.518 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
4:00.128 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
4:01.868 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
4:03.176 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:04.484 default 9 soul_fire Fluffy_Pillow 49060.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
4:07.961 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.2/5: 84% soul_shard
backdraft
4:10.741 aoe E soul_rot Fluffy_Pillow 49642.0/50000: 99% mana
4.6/5: 92% soul_shard
backdraft
4:12.047 aoe G immolate enemy2 49752.0/50000: 100% mana
4.8/5: 96% soul_shard
soul_rot
4:13.354 aoe G immolate enemy3 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
soul_rot
4:14.660 aoe J rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
4.9/5: 98% soul_shard
soul_rot
4:15.965 default A cataclysm Fluffy_Pillow 49808.0/50000: 100% mana
2.0/5: 40% soul_shard
soul_rot
4:17.706 aoe K conflagrate Fluffy_Pillow 49502.5/50000: 99% mana
2.2/5: 44% soul_shard
soul_rot
4:19.011 aoe L incinerate Fluffy_Pillow 49655.0/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, soul_rot
4:20.230 aoe J rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.3/5: 66% soul_shard
4:21.538 aoe I havoc enemy2 49656.0/50000: 99% mana
0.4/5: 8% soul_shard
4:23.077 havoc R incinerate Fluffy_Pillow 49425.5/50000: 99% mana
0.6/5: 12% soul_shard
4:24.818 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
4:26.124 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:27.951 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:29.691 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
4:30.998 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:32.304 havoc R incinerate Fluffy_Pillow 49058.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
4:33.524 aoe F channel_demonfire Fluffy_Pillow 48668.5/50000: 97% mana
3.3/5: 66% soul_shard
4:36.294 aoe G immolate enemy3 49303.5/50000: 99% mana
3.7/5: 74% soul_shard
4:37.600 aoe J rain_of_fire Fluffy_Pillow 49206.5/50000: 98% mana
3.8/5: 76% soul_shard
4:38.906 aoe K conflagrate Fluffy_Pillow 49859.5/50000: 100% mana
1.0/5: 20% soul_shard
4:40.212 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft
4:41.432 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
4:43.172 aoe L incinerate Fluffy_Pillow 48872.5/50000: 98% mana
2.4/5: 48% soul_shard
4:44.911 aoe K conflagrate Fluffy_Pillow 48742.0/50000: 97% mana
2.9/5: 58% soul_shard
4:46.218 aoe J rain_of_fire Fluffy_Pillow 48895.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
4:47.523 default A cataclysm Fluffy_Pillow 49548.0/50000: 99% mana
0.7/5: 14% soul_shard
backdraft
4:49.442 aoe L incinerate Fluffy_Pillow 49502.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
4:50.661 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
4:52.401 aoe I havoc enemy2 48872.0/50000: 98% mana
1.7/5: 34% soul_shard
4:53.708 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
2.0/5: 40% soul_shard
4:55.014 havoc O soul_fire Fluffy_Pillow 48678.5/50000: 97% mana
3.1/5: 62% soul_shard
backdraft
4:58.492 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
5:00.319 havoc Q chaos_bolt Fluffy_Pillow 49916.0/50000: 100% mana
3.0/5: 60% soul_shard
5:02.927 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
5:04.233 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft
5:07.075 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
5:08.295 aoe G immolate enemy3 49002.5/50000: 98% mana
3.1/5: 62% soul_shard
5:09.602 aoe G immolate Fluffy_Pillow 48906.0/50000: 98% mana
3.4/5: 68% soul_shard
5:10.909 aoe G immolate enemy2 48809.5/50000: 98% mana
3.5/5: 70% soul_shard
5:12.215 aoe E soul_rot Fluffy_Pillow 48712.5/50000: 97% mana
3.7/5: 74% soul_shard
5:13.520 aoe J rain_of_fire Fluffy_Pillow 49115.0/50000: 98% mana
3.8/5: 76% soul_shard
soul_rot
5:14.829 aoe K conflagrate Fluffy_Pillow 49769.5/50000: 100% mana
1.0/5: 20% soul_shard
soul_rot
5:16.133 aoe L incinerate Fluffy_Pillow 49921.5/50000: 100% mana
1.6/5: 32% soul_shard
backdraft, soul_rot
5:17.352 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Dream"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Dream_SB : 9771 dps, 5248 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9770.7 9770.7 16.8 / 0.172% 807.9 / 8.3% 21.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.8 386.3 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream_SB 9771
Cataclysm 784 8.0% 9.7 32.34sec 24277 14287 Direct 29.1 6805 13610 8094 18.9%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.70 29.11 0.00 0.00 1.6993 0.0000 235571.50 235571.50 0.00% 14286.59 14286.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 23.61 12 34 6804.66 6141 7454 6804.12 6560 7014 160628 160628 0.00%
crit 18.91% 5.50 0 13 13610.25 12285 14908 13597.19 0 14750 74943 74943 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.77
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1037) 0.0% (10.6%) 12.0 25.74sec 25829 9591

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.05 0.00 179.92 0.00 2.6932 0.1634 0.00 0.00 0.00% 9590.78 9590.78

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.05
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1037 10.6% 0.0 0.00sec 0 0 Direct 539.8 483 966 577 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 539.75 0.00 0.00 0.0000 0.0000 311192.11 311192.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 435.62 321 570 483.29 263 1002 483.59 455 511 210547 210547 0.00%
crit 19.29% 104.13 62 158 966.43 525 2004 966.41 817 1113 100645 100645 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1316 (1770) 13.5% (18.1%) 21.6 13.53sec 24512 12507 Direct 43.0 (85.7) 0 9163 9163 100.0% (59.6%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.64 43.04 0.00 0.00 1.9599 0.0000 394384.06 394384.06 0.00% 12507.04 12507.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.04 32 58 9163.00 5875 12567 9163.25 8954 9366 394384 394384 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.76
  • if_expr:cast_time<havoc_remains
    Internal Combustion 454 4.6% 42.6 13.55sec 3189 0 Direct 42.6 2682 5364 3191 18.9%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.65 42.65 0.00 0.00 0.0000 0.0000 136002.02 136002.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 34.58 22 50 2682.25 28 3916 2684.47 2495 2885 92773 92773 0.00%
crit 18.91% 8.06 1 17 5363.67 2 7815 5357.57 2777 6960 43229 43229 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 818 8.4% 37.0 7.97sec 6640 5308 Direct 56.7 3632 7294 4333 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.98 56.67 0.00 0.00 1.2510 0.0000 245539.50 245539.50 0.00% 5307.81 5307.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 45.82 31 61 3631.67 2047 5177 3631.75 3386 3898 166390 166390 0.00%
crit 19.14% 10.85 1 23 7293.97 4096 10353 7301.94 5517 9807 79150 79150 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.27
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.70
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1628 16.7% 26.6 10.89sec 18366 14560 Direct 33.8 1553 3102 1854 19.4%
Periodic 347.7 1028 2054 1226 19.3% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.63 33.82 347.67 347.67 1.2614 2.4845 489073.04 489073.04 0.00% 545.02 14559.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 27.24 17 39 1552.66 820 2071 1552.90 1419 1689 42295 42295 0.00%
crit 19.45% 6.58 1 13 3101.52 1640 4141 3106.32 2417 4038 20403 20403 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.65% 280.41 216 365 1027.81 0 1294 1027.88 1008 1044 288215 288215 0.00%
crit 19.35% 67.26 37 104 2053.85 5 2588 2053.99 1954 2146 138161 138161 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.94
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.81
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 623 6.4% 44.9 6.07sec 4177 2851 Direct 55.7 (55.7) 2826 5664 3366 19.0% (19.0%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.90 55.74 0.00 0.00 1.4647 0.0000 187528.33 187528.33 0.00% 2851.40 2851.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.00% 45.15 25 64 2825.80 1313 3517 2828.51 2638 3064 127588 127588 0.00%
crit 19.00% 10.59 3 21 5663.67 2721 7035 5667.46 4302 6613 59941 59941 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.94
    havoc
    [R]:11.20
  • if_expr:cast_time<havoc_remains
Rain of Fire 926 9.5% 17.5 16.22sec 15852 12719 Periodic 416.2 561 1121 668 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.54 0.00 0.00 416.16 1.2464 0.0000 278053.10 278053.10 0.00% 12718.56 12718.56
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.82% 336.36 216 463 560.59 507 615 560.58 551 570 188561 188561 0.00%
crit 19.18% 79.80 43 119 1121.45 1013 1230 1121.45 1098 1141 89492 89492 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.33
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.21
Soul Fire 519 5.3% 5.6 49.51sec 27973 8044 Direct 7.9 16629 32975 19837 19.6%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.58 7.87 0.00 0.00 3.4775 0.0000 156091.28 156091.28 0.00% 8043.87 8043.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.44% 6.33 2 11 16628.94 8599 21739 16675.61 12565 20779 105337 105337 0.00%
crit 19.56% 1.54 0 6 32975.47 17245 43428 27066.87 0 43142 50754 50754 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.33
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.34
  • if_expr:cast_time<havoc_remains
Soul Rot 343 3.5% 5.3 62.42sec 19532 15634 Periodic 96.6 895 1785 1065 19.1% 13.8%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.26 0.00 96.61 96.61 1.2495 1.2896 102825.84 102825.84 0.00% 783.98 15634.16
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.92% 78.17 55 98 894.53 424 1432 894.98 838 949 69934 69934 0.00%
crit 19.08% 18.44 7 32 1785.00 849 2865 1785.41 1376 2272 32892 32892 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.28
Summon Infernal 81 0.8% 2.0 180.52sec 12078 10443 Direct 6.0 3379 6755 4028 19.2%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24155.36 24155.36 0.00% 10443.30 10443.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 4.85 1 6 3378.64 3348 3437 3378.51 3348 3437 16384 16384 0.00%
crit 19.18% 1.15 0 5 6754.82 6696 6875 4773.02 0 6875 7772 7772 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3555 / 719
Immolation 3286 6.7% 39.0 5.49sec 5055 0 Direct 117.0 1414 2828 1685 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 197157.81 197157.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 94.58 80 106 1414.17 1395 1432 1414.17 1411 1417 133757 133757 0.00%
crit 19.16% 22.42 11 37 2828.33 2790 2865 2828.23 2800 2848 63401 63401 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 269 0.6% 41.0 5.25sec 394 274 Direct 41.0 330 660 394 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16148.63 23066.70 29.99% 274.15 274.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 33.05 24 40 329.95 326 334 329.94 329 332 10906 15578 29.99%
crit 19.38% 7.95 1 17 659.80 651 668 659.81 651 668 5242 7488 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 520 / 520
Firebolt 520 5.3% 93.4 3.22sec 1671 1148 Direct 92.7 1414 2828 1685 19.1%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.42 92.71 0.00 0.00 1.4561 0.0000 156142.51 156142.51 0.00% 1147.85 1147.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.90% 75.00 56 99 1414.12 1395 1432 1414.13 1411 1417 106064 106064 0.00%
crit 19.10% 17.71 7 36 2827.70 2790 2865 2827.59 2800 2854 50079 50079 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.87
Simple Action Stats Execute Interval
NightFae_Dream_SB
Havoc 9.7 32.01sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.66 0.00 0.00 0.00 1.2444 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.66
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 8.0sec 8.0sec 4.1sec 50.69% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.1s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.69%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Social Butterfly 30.5 0.0 10.0sec 10.0sec 5.0sec 50.41% 0.00% 0.0 (0.0) 30.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.41%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.85% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.7s
  • trigger_min/max:61.3s / 68.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • soul_rot_1:13.85%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.0s
  • trigger_min/max:180.0s / 185.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.0s
  • trigger_min/max:180.0s / 185.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.13% 11.05% 17.34% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream_SB
soul_fire Soul Shard 6.59 7.18 7.55% 1.09 0.74 9.37%
immolate Soul Shard 347.62 33.60 35.31% 0.10 1.16 3.34%
incinerate Soul Shard 44.91 11.19 11.77% 0.25 0.01 0.13%
conflagrate Soul Shard 36.96 28.33 29.77% 0.77 0.00 0.00%
mana_regen Mana 660.46 116059.67 100.00% 175.73 33841.86 22.58%
immolate_crits Soul Shard 33.73 3.26 3.42% 0.10 0.12 3.46%
incinerate_crits Soul Shard 10.60 1.06 1.11% 0.10 0.00 0.18%
infernal Soul Shard 120.00 10.53 11.07% 0.09 1.47 12.21%
pet - imp
energy_regen Energy 361.58 3565.87 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.26 388.79 33863.6 49238.4 47850.5 50000.0
Soul Shard 4.0 0.32 0.32 3.5 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Dream_SB
cataclysm Mana 9.7 4855.5 500.0 500.4 48.5
channel_demonfire Mana 12.1 9039.8 750.0 750.3 34.4
chaos_bolt Soul Shard 21.6 43.2 2.0 2.0 12269.5
conflagrate Mana 37.0 18482.0 500.0 499.8 13.3
havoc Mana 9.7 9662.5 1000.0 1000.6 0.0
immolate Mana 26.6 19968.8 750.0 749.9 24.5
incinerate Mana 44.9 44906.2 1000.0 1000.1 4.2
rain_of_fire Soul Shard 17.5 52.6 3.0 3.0 5284.5
soul_fire Mana 6.6 6590.6 1000.0 1181.1 23.7
soul_rot Mana 5.3 1314.5 250.0 249.7 78.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 93.4 3736.5 40.0 40.0 41.8

Statistics & Data Analysis

Fight Length
NightFae_Dream_SB Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Dream_SB Damage Per Second
Count 624
Mean 9770.66
Minimum 9177.13
Maximum 10444.16
Spread ( max - min ) 1267.02
Range [ ( max - min ) / 2 * 100% ] 6.48%
Standard Deviation 214.3513
5th Percentile 9436.74
95th Percentile 10124.91
( 95th Percentile - 5th Percentile ) 688.17
Mean Distribution
Standard Deviation 8.5809
95.00% Confidence Interval ( 9753.84 - 9787.48 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1849
0.1 Scale Factor Error with Delta=300 393
0.05 Scale Factor Error with Delta=300 1569
0.01 Scale Factor Error with Delta=300 39223
Priority Target DPS
NightFae_Dream_SB Priority Target Damage Per Second
Count 624
Mean 5247.74
Minimum 4841.94
Maximum 5674.55
Spread ( max - min ) 832.61
Range [ ( max - min ) / 2 * 100% ] 7.93%
Standard Deviation 127.3407
5th Percentile 5057.64
95th Percentile 5453.07
( 95th Percentile - 5th Percentile ) 395.43
Mean Distribution
Standard Deviation 5.0977
95.00% Confidence Interval ( 5237.75 - 5257.73 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2262
0.1 Scale Factor Error with Delta=300 139
0.05 Scale Factor Error with Delta=300 554
0.01 Scale Factor Error with Delta=300 13843
DPS(e)
NightFae_Dream_SB Damage Per Second (Effective)
Count 624
Mean 9770.66
Minimum 9177.13
Maximum 10444.16
Spread ( max - min ) 1267.02
Range [ ( max - min ) / 2 * 100% ] 6.48%
Damage
NightFae_Dream_SB Damage
Count 624
Mean 2560416.13
Minimum 2005101.28
Maximum 3153096.60
Spread ( max - min ) 1147995.32
Range [ ( max - min ) / 2 * 100% ] 22.42%
DTPS
NightFae_Dream_SB Damage Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream_SB Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream_SB Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream_SB Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream_SB Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream_SB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Dream_SBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream_SB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.33 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.77 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.33 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.28 soul_rot
F 12.05 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.94 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.66 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.21 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.27 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.94 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.70 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.34 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.81 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.76 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.20 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGGDLKLLDKALLKFIQQPONJLGKLJFKLAELLINQQPRNFGJLKLLL9AJINQRNQPFKLLGLGJKLELAINQRQNP9FJGKLLJKLLAINQRQRPNFLLGJKMLEG9AIQNQNQPNDFDLGKGGLLJKAIRQRRNP9FJGKELJKLLLAINQQRNPFLJKLGLLKG9AIQNQQPRNFJLEGKGGL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
social_butterfly
0:01.739 aoe E soul_rot Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, social_butterfly
0:02.743 aoe F channel_demonfire Fluffy_Pillow 49621.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot, social_butterfly
0:05.039 cds M summon_infernal Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:06.046 aoe I havoc enemy2 49503.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:07.053 havoc Q chaos_bolt Fluffy_Pillow 49007.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:09.062 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:10.069 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot, social_butterfly
0:11.476 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, social_butterfly
0:12.483 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, social_butterfly
0:13.488 havoc Q chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, social_butterfly
0:14.897 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, social_butterfly
0:15.903 havoc Q chaos_bolt Fluffy_Pillow 49959.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:17.308 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:18.315 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:19.321 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:21.632 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
bloodlust, backdraft, social_butterfly
0:22.640 aoe G immolate enemy2 49253.0/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, social_butterfly
0:23.645 aoe G immolate enemy3 49005.5/50000: 98% mana
2.8/5: 56% soul_shard
bloodlust, backdraft, social_butterfly
0:24.651 aoe D rain_of_fire Fluffy_Pillow 48758.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft, social_butterfly
0:25.657 aoe L incinerate Fluffy_Pillow 49261.5/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:26.597 aoe K conflagrate Fluffy_Pillow 48731.5/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust
0:27.603 aoe L incinerate Fluffy_Pillow 48734.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:28.543 aoe L incinerate Fluffy_Pillow 48204.5/50000: 96% mana
2.4/5: 48% soul_shard
bloodlust
0:29.884 aoe D rain_of_fire Fluffy_Pillow 47875.0/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust
0:30.889 aoe K conflagrate Fluffy_Pillow 48377.5/50000: 97% mana
0.4/5: 8% soul_shard
bloodlust, social_butterfly
0:31.895 default A cataclysm Fluffy_Pillow 48380.5/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust, backdraft, social_butterfly
0:33.235 aoe L incinerate Fluffy_Pillow 48550.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft, social_butterfly
0:34.175 aoe L incinerate Fluffy_Pillow 48020.5/50000: 96% mana
2.5/5: 50% soul_shard
bloodlust, social_butterfly
0:35.516 aoe K conflagrate Fluffy_Pillow 47691.0/50000: 95% mana
3.0/5: 60% soul_shard
bloodlust
0:36.680 aoe F channel_demonfire Fluffy_Pillow 47773.0/50000: 96% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:38.937 aoe I havoc enemy2 48151.5/50000: 96% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:39.945 havoc Q chaos_bolt Fluffy_Pillow 47655.5/50000: 95% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:41.352 havoc Q chaos_bolt Fluffy_Pillow 48359.0/50000: 97% mana
2.4/5: 48% soul_shard
social_butterfly
0:43.962 havoc P immolate Fluffy_Pillow 49664.0/50000: 99% mana
0.7/5: 14% soul_shard
social_butterfly
0:45.271 havoc O soul_fire Fluffy_Pillow 49253.5/50000: 99% mana
0.9/5: 18% soul_shard
0:48.750 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
3.3/5: 66% soul_shard
0:50.055 aoe J rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
4.5/5: 90% soul_shard
backdraft, social_butterfly
0:51.361 aoe L incinerate Fluffy_Pillow 49808.5/50000: 100% mana
1.6/5: 32% soul_shard
backdraft, social_butterfly
0:52.579 aoe G immolate enemy3 49001.5/50000: 98% mana
2.0/5: 40% soul_shard
social_butterfly
0:53.886 aoe K conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
2.1/5: 42% soul_shard
social_butterfly
0:55.192 aoe L incinerate Fluffy_Pillow 49058.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
0:56.414 aoe J rain_of_fire Fluffy_Pillow 48669.0/50000: 97% mana
3.2/5: 64% soul_shard
0:57.720 aoe F channel_demonfire Fluffy_Pillow 49322.0/50000: 99% mana
0.4/5: 8% soul_shard
1:00.689 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
social_butterfly
1:01.996 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft, social_butterfly
1:03.215 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
social_butterfly
1:04.972 aoe E soul_rot Fluffy_Pillow 49380.5/50000: 99% mana
1.9/5: 38% soul_shard
social_butterfly
1:06.279 aoe L incinerate Fluffy_Pillow 49752.5/50000: 100% mana
2.2/5: 44% soul_shard
soul_rot
1:08.019 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
soul_rot
1:09.760 aoe I havoc enemy2 48872.5/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot
1:11.067 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
3.1/5: 62% soul_shard
soul_rot, social_butterfly
1:12.373 havoc Q chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
4.2/5: 84% soul_shard
backdraft, soul_rot, social_butterfly
1:14.201 havoc Q chaos_bolt Fluffy_Pillow 49593.0/50000: 99% mana
2.5/5: 50% soul_shard
soul_rot, social_butterfly
1:16.809 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:18.117 havoc R incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.8/5: 16% soul_shard
1:19.858 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
1:21.165 aoe F channel_demonfire Fluffy_Pillow 49156.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, social_butterfly
1:23.992 aoe G immolate enemy3 49819.5/50000: 100% mana
3.0/5: 60% soul_shard
backdraft, social_butterfly
1:25.299 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:26.604 aoe L incinerate Fluffy_Pillow 49905.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
1:27.824 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
1:29.130 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
1:30.350 aoe L incinerate Fluffy_Pillow 48765.5/50000: 98% mana
1.6/5: 32% soul_shard
social_butterfly
1:32.089 aoe L incinerate Fluffy_Pillow 48635.0/50000: 97% mana
2.0/5: 40% soul_shard
social_butterfly
1:33.830 default 9 soul_fire Fluffy_Pillow 48505.5/50000: 97% mana
2.4/5: 48% soul_shard
social_butterfly
1:37.308 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.8/5: 76% soul_shard
1:39.048 aoe J rain_of_fire Fluffy_Pillow 49372.5/50000: 99% mana
4.0/5: 80% soul_shard
1:40.353 aoe I havoc enemy2 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
social_butterfly
1:41.658 havoc N conflagrate Fluffy_Pillow 49652.5/50000: 99% mana
1.4/5: 28% soul_shard
social_butterfly
1:42.967 havoc Q chaos_bolt Fluffy_Pillow 49807.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft, social_butterfly
1:44.794 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
social_butterfly
1:46.533 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.2/5: 24% soul_shard
1:47.839 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:49.666 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:50.972 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
social_butterfly
1:53.771 aoe K conflagrate Fluffy_Pillow 49901.5/50000: 100% mana
1.2/5: 24% soul_shard
social_butterfly
1:55.077 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft
1:56.297 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
1:58.039 aoe G immolate enemy3 48873.5/50000: 98% mana
2.6/5: 52% soul_shard
1:59.345 aoe L incinerate Fluffy_Pillow 48776.5/50000: 98% mana
2.7/5: 54% soul_shard
2:01.084 aoe G immolate enemy2 48646.0/50000: 97% mana
3.3/5: 66% soul_shard
social_butterfly
2:02.389 aoe J rain_of_fire Fluffy_Pillow 48548.5/50000: 97% mana
3.3/5: 66% soul_shard
social_butterfly
2:03.697 aoe K conflagrate Fluffy_Pillow 49202.5/50000: 98% mana
0.7/5: 14% soul_shard
social_butterfly
2:05.003 aoe L incinerate Fluffy_Pillow 49355.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
2:06.223 aoe E soul_rot Fluffy_Pillow 48965.5/50000: 98% mana
1.7/5: 34% soul_shard
2:07.580 aoe L incinerate Fluffy_Pillow 49394.0/50000: 99% mana
1.7/5: 34% soul_shard
soul_rot
2:09.319 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
2.2/5: 44% soul_shard
soul_rot
2:11.060 aoe I havoc enemy2 49372.0/50000: 99% mana
2.4/5: 48% soul_shard
soul_rot, social_butterfly
2:12.366 havoc N conflagrate Fluffy_Pillow 49025.0/50000: 98% mana
2.5/5: 50% soul_shard
soul_rot, social_butterfly
2:13.673 havoc Q chaos_bolt Fluffy_Pillow 49178.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft, soul_rot, social_butterfly
2:15.500 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
soul_rot
2:17.242 havoc Q chaos_bolt Fluffy_Pillow 49003.0/50000: 98% mana
2.6/5: 52% soul_shard
2:19.854 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
2:21.161 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft, social_butterfly
2:22.465 default 9 soul_fire Fluffy_Pillow 49251.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, social_butterfly
2:25.943 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
2:28.755 aoe J rain_of_fire Fluffy_Pillow 49658.5/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
2:30.061 aoe G immolate enemy3 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
social_butterfly
2:31.368 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.4/5: 28% soul_shard
social_butterfly
2:32.675 aoe L incinerate Fluffy_Pillow 49406.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, social_butterfly
2:33.893 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.5/5: 50% soul_shard
social_butterfly
2:35.634 aoe J rain_of_fire Fluffy_Pillow 48872.0/50000: 98% mana
3.0/5: 60% soul_shard
2:36.941 aoe K conflagrate Fluffy_Pillow 49525.5/50000: 99% mana
0.1/5: 2% soul_shard
2:38.246 aoe L incinerate Fluffy_Pillow 49678.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
2:39.463 aoe L incinerate Fluffy_Pillow 49001.0/50000: 98% mana
1.2/5: 24% soul_shard
2:41.203 default A cataclysm Fluffy_Pillow 48871.0/50000: 98% mana
1.6/5: 32% soul_shard
social_butterfly
2:42.943 aoe I havoc enemy2 49241.0/50000: 98% mana
1.9/5: 38% soul_shard
social_butterfly
2:44.250 havoc N conflagrate Fluffy_Pillow 48894.5/50000: 98% mana
2.0/5: 40% soul_shard
social_butterfly
2:45.556 havoc Q chaos_bolt Fluffy_Pillow 49047.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:47.382 havoc R incinerate Fluffy_Pillow 49960.5/50000: 100% mana
1.3/5: 26% soul_shard
2:49.122 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
2:51.731 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
social_butterfly
2:53.472 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
social_butterfly
2:54.779 havoc N conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.0/5: 20% soul_shard
social_butterfly
2:56.087 aoe F channel_demonfire Fluffy_Pillow 49060.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
2:59.010 aoe L incinerate Fluffy_Pillow 49771.5/50000: 100% mana
2.6/5: 52% soul_shard
backdraft
3:00.230 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.9/5: 58% soul_shard
social_butterfly
3:01.972 aoe G immolate enemy3 48873.5/50000: 98% mana
3.3/5: 66% soul_shard
social_butterfly
3:03.278 aoe J rain_of_fire Fluffy_Pillow 48776.5/50000: 98% mana
3.4/5: 68% soul_shard
social_butterfly
3:04.583 aoe K conflagrate Fluffy_Pillow 49429.0/50000: 99% mana
0.8/5: 16% soul_shard
social_butterfly
3:05.889 cds M summon_infernal Fluffy_Pillow 49582.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
3:07.194 aoe L incinerate Fluffy_Pillow 49234.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:08.414 aoe E soul_rot Fluffy_Pillow 48844.5/50000: 98% mana
2.5/5: 50% soul_shard
3:09.721 aoe G immolate enemy2 49248.0/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot
3:11.026 default 9 soul_fire Fluffy_Pillow 49150.5/50000: 98% mana
3.3/5: 66% soul_shard
soul_rot, social_butterfly
3:14.503 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
soul_rot, social_butterfly
3:16.245 aoe I havoc enemy2 49373.0/50000: 99% mana
5.0/5: 100% soul_shard
soul_rot
3:17.550 havoc Q chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
5.0/5: 100% soul_shard
soul_rot
3:20.161 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
social_butterfly
3:21.466 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, social_butterfly
3:23.293 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
social_butterfly
3:24.599 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, social_butterfly
3:26.426 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.731 havoc N conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
3.4/5: 68% soul_shard
3:29.040 aoe D rain_of_fire Fluffy_Pillow 49406.0/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:30.345 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft, social_butterfly
3:33.170 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft, social_butterfly
3:34.476 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, social_butterfly
3:35.697 aoe G immolate enemy3 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
3:37.004 aoe K conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
1.5/5: 30% soul_shard
3:38.313 aoe G immolate enemy2 49061.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
3:39.618 aoe G immolate Fluffy_Pillow 48963.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:40.925 aoe L incinerate Fluffy_Pillow 48867.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, social_butterfly
3:42.144 aoe L incinerate Fluffy_Pillow 48476.5/50000: 97% mana
2.9/5: 58% soul_shard
social_butterfly
3:43.883 aoe J rain_of_fire Fluffy_Pillow 48346.0/50000: 97% mana
3.3/5: 66% soul_shard
social_butterfly
3:45.191 aoe K conflagrate Fluffy_Pillow 49000.0/50000: 98% mana
0.6/5: 12% soul_shard
3:46.499 default A cataclysm Fluffy_Pillow 49154.0/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
3:48.240 aoe I havoc enemy2 49502.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
3:49.547 havoc R incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
3:50.767 havoc Q chaos_bolt Fluffy_Pillow 48766.0/50000: 98% mana
2.1/5: 42% soul_shard
social_butterfly
3:53.374 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
social_butterfly
3:55.114 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
3:56.856 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
1.5/5: 30% soul_shard
3:58.160 havoc P immolate Fluffy_Pillow 49025.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
3:59.466 default 9 soul_fire Fluffy_Pillow 48928.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
4:02.976 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.3/5: 86% soul_shard
backdraft, social_butterfly
4:05.865 aoe J rain_of_fire Fluffy_Pillow 49696.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
4:07.172 aoe G immolate enemy3 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
4:08.479 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.1/5: 42% soul_shard
4:09.786 aoe E soul_rot Fluffy_Pillow 49406.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
4:11.093 aoe L incinerate Fluffy_Pillow 49752.5/50000: 100% mana
3.0/5: 60% soul_shard
backdraft, soul_rot, social_butterfly
4:12.313 aoe J rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
soul_rot, social_butterfly
4:13.618 aoe K conflagrate Fluffy_Pillow 49655.0/50000: 99% mana
0.4/5: 8% soul_shard
soul_rot, social_butterfly
4:14.924 aoe L incinerate Fluffy_Pillow 49808.0/50000: 100% mana
1.0/5: 20% soul_shard
backdraft, soul_rot, social_butterfly
4:16.143 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
soul_rot
4:17.884 aoe L incinerate Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
soul_rot
4:19.625 default A cataclysm Fluffy_Pillow 48743.0/50000: 97% mana
2.3/5: 46% soul_shard
4:21.367 aoe I havoc enemy2 49114.0/50000: 98% mana
2.5/5: 50% soul_shard
social_butterfly
4:22.672 havoc N conflagrate Fluffy_Pillow 48766.5/50000: 98% mana
2.7/5: 54% soul_shard
social_butterfly
4:23.978 havoc Q chaos_bolt Fluffy_Pillow 48919.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft, social_butterfly
4:25.807 havoc Q chaos_bolt Fluffy_Pillow 49834.0/50000: 100% mana
2.1/5: 42% soul_shard
4:28.418 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
4:30.158 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
social_butterfly
4:31.464 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, social_butterfly
4:32.771 aoe F channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, social_butterfly
4:35.730 aoe L incinerate Fluffy_Pillow 49788.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
4:36.948 aoe J rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
3.3/5: 66% soul_shard
4:38.256 aoe K conflagrate Fluffy_Pillow 49655.5/50000: 99% mana
0.5/5: 10% soul_shard
4:39.562 aoe L incinerate Fluffy_Pillow 49808.5/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
4:40.783 aoe G immolate enemy3 49003.0/50000: 98% mana
1.5/5: 30% soul_shard
social_butterfly
4:42.088 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
1.5/5: 30% soul_shard
social_butterfly
4:43.830 aoe L incinerate Fluffy_Pillow 48776.5/50000: 98% mana
2.1/5: 42% soul_shard
social_butterfly
4:45.570 aoe K conflagrate Fluffy_Pillow 48646.5/50000: 97% mana
2.5/5: 50% soul_shard
4:46.877 aoe G immolate enemy2 48800.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
4:48.183 default 9 soul_fire Fluffy_Pillow 48703.0/50000: 97% mana
3.4/5: 68% soul_shard
backdraft
4:51.661 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft, social_butterfly
4:53.400 aoe I havoc enemy2 49372.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, social_butterfly
4:54.706 havoc Q chaos_bolt Fluffy_Pillow 49025.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, social_butterfly
4:56.532 havoc N conflagrate Fluffy_Pillow 49938.0/50000: 100% mana
3.0/5: 60% soul_shard
4:57.839 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
backdraft
4:59.666 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
5:02.277 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
social_butterfly
5:03.583 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
social_butterfly
5:05.324 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
5:06.632 aoe F channel_demonfire Fluffy_Pillow 49156.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
5:09.467 aoe J rain_of_fire Fluffy_Pillow 49824.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
5:10.773 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft, social_butterfly
5:11.992 aoe E soul_rot Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
social_butterfly
5:13.299 aoe G immolate enemy3 49405.5/50000: 99% mana
0.9/5: 18% soul_shard
soul_rot, social_butterfly
5:14.606 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.3/5: 26% soul_shard
soul_rot, social_butterfly
5:15.914 aoe G immolate enemy2 49406.5/50000: 99% mana
1.8/5: 36% soul_shard
backdraft, soul_rot
5:17.220 aoe G immolate Fluffy_Pillow 49252.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, soul_rot
5:18.527 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Dream_SB"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=319210/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Niya : 9958 dps, 5344 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9958.2 9958.2 17.6 / 0.177% 813.5 / 8.2% 22.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.6 386.1 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 9958
Cataclysm 796 8.0% 9.7 32.38sec 24624 14492 Direct 29.1 6887 13768 8213 19.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.71 29.12 0.00 0.00 1.6993 0.0000 238979.61 238979.61 0.00% 14491.52 14491.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 23.52 14 35 6887.37 6142 8173 6884.57 6543 7144 161994 161994 0.00%
crit 19.21% 5.59 0 13 13768.07 12284 16193 13710.75 0 15769 76985 76985 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.76
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1064) 0.0% (10.7%) 12.0 25.55sec 26500 9836

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.05 0.00 180.05 0.00 2.6941 0.1634 0.00 0.00 0.00% 9836.40 9836.40

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.05
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1064 10.7% 0.0 0.00sec 0 0 Direct 540.1 496 990 591 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 540.15 0.00 0.00 0.0000 0.0000 319230.68 319230.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 436.17 304 592 495.86 263 1094 496.28 469 523 216325 216325 0.00%
crit 19.25% 103.98 66 154 990.06 525 2164 990.67 840 1192 102906 102906 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1361 (1830) 13.7% (18.4%) 21.7 13.50sec 25270 12895 Direct 43.2 (86.1) 0 9442 9442 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.71 43.22 0.00 0.00 1.9596 0.0000 408097.75 408097.75 0.00% 12895.44 12895.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.22 32 58 9442.30 5881 13645 9441.63 9217 9703 408098 408098 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.80
  • if_expr:cast_time<havoc_remains
    Internal Combustion 469 4.7% 42.9 13.53sec 3275 0 Direct 42.9 2744 5512 3277 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.87 42.87 0.00 0.00 0.0000 0.0000 140384.20 140384.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 34.63 24 49 2743.55 1 4099 2744.27 2507 2962 95006 95006 0.00%
crit 19.20% 8.23 1 19 5512.32 35 8233 5515.81 3852 7197 45378 45378 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 841 8.4% 37.0 7.96sec 6820 5454 Direct 56.6 3745 7462 4454 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.96 56.60 0.00 0.00 1.2507 0.0000 252095.46 252095.46 0.00% 5453.54 5453.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 45.79 31 60 3745.34 2048 5640 3744.27 3460 4043 171474 171474 0.00%
crit 19.09% 10.81 2 22 7461.58 4096 11172 7455.39 5661 9488 80622 80622 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.33
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.62
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1676 16.9% 26.8 10.87sec 18806 14906 Direct 34.0 1595 3200 1913 19.9%
Periodic 347.9 1056 2113 1260 19.3% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.77 34.01 347.93 347.93 1.2617 2.4839 503464.92 503464.92 0.00% 560.65 14906.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.15% 27.26 17 43 1595.06 822 2236 1596.38 1457 1723 43484 43484 0.00%
crit 19.85% 6.75 1 16 3199.81 1649 4456 3196.60 2203 4200 21592 21592 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.69% 280.73 207 352 1055.71 1 1420 1055.81 1035 1078 296377 296377 0.00%
crit 19.31% 67.20 37 95 2113.07 3 2845 2113.27 1997 2205 142012 142012 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:18.01
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.87
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 636 6.4% 44.7 6.10sec 4279 2921 Direct 55.5 (55.5) 2899 5822 3452 18.9% (18.9%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.74 55.47 0.00 0.00 1.4649 0.0000 191424.67 191424.67 0.00% 2920.91 2920.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.11% 44.99 25 66 2899.22 1331 3831 2900.31 2718 3101 130425 130425 0.00%
crit 18.89% 10.48 2 21 5821.76 2683 7591 5823.91 4411 6784 60999 60999 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.89
    havoc
    [R]:11.13
  • if_expr:cast_time<havoc_remains
Rain of Fire 950 9.5% 17.5 16.46sec 16291 13061 Periodic 414.7 576 1153 687 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.50 0.00 0.00 414.70 1.2473 0.0000 285034.93 285034.93 0.00% 13061.22 13061.22
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.72% 334.76 233 468 576.22 507 681 576.12 564 589 192880 192880 0.00%
crit 19.28% 79.94 50 134 1152.96 1013 1363 1152.85 1122 1183 92155 92155 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.29
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.21
Soul Fire 523 5.3% 5.6 49.39sec 28120 8086 Direct 7.8 16861 33674 20032 18.9%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.59 7.84 0.00 0.00 3.4775 0.0000 157095.46 157095.46 0.00% 8086.45 8086.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.14% 6.36 2 10 16860.68 8604 23245 16912.71 13621 20151 107260 107260 0.00%
crit 18.86% 1.48 0 5 33673.55 17404 46863 26365.86 0 45115 49835 49835 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.37
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.31
  • if_expr:cast_time<havoc_remains
Soul Rot 339 3.4% 5.3 62.42sec 19351 15489 Periodic 96.6 882 1768 1053 19.4% 13.8%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.26 0.00 96.62 96.62 1.2495 1.2898 101809.76 101809.76 0.00% 776.05 15489.09
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.65% 77.92 50 102 882.48 424 1395 882.70 824 939 68772 68772 0.00%
crit 19.35% 18.70 8 35 1767.68 849 2790 1766.69 1370 2321 33038 33038 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.28
Summon Infernal 81 0.8% 2.0 180.72sec 11938 10327 Direct 6.0 3348 6696 3979 18.9%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1564 0.0000 23876.92 23876.92 0.00% 10327.39 10327.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.14% 4.87 1 6 3348.13 3348 3348 3348.13 3348 3348 16301 16301 0.00%
crit 18.86% 1.13 0 5 6696.27 6696 6696 4904.16 0 6696 7576 7576 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3507 / 710
Immolation 3242 6.5% 39.0 5.50sec 4987 0 Direct 117.0 1395 2790 1663 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194500.80 194500.80 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 94.58 81 108 1395.06 1395 1395 1395.06 1395 1395 131942 131942 0.00%
crit 19.16% 22.42 9 36 2790.11 2790 2790 2790.11 2790 2790 62558 62558 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.26sec 388 270 Direct 41.0 326 651 388 19.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15909.80 22725.56 29.99% 270.10 270.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 33.13 26 40 325.55 326 326 325.55 326 326 10785 15406 29.99%
crit 19.20% 7.87 1 15 651.10 651 651 651.10 651 651 5124 7320 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 513 / 513
Firebolt 513 5.2% 93.4 3.22sec 1647 1131 Direct 92.7 1395 2790 1660 19.0%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.42 92.71 0.00 0.00 1.4561 0.0000 153880.96 153880.96 0.00% 1131.24 1131.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.03% 75.12 54 99 1395.06 1395 1395 1395.06 1395 1395 104799 104799 0.00%
crit 18.97% 17.59 7 30 2790.11 2790 2790 2790.11 2790 2790 49082 49082 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.87
Simple Action Stats Execute Interval
NightFae_Niya
Havoc 9.7 32.03sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.66 0.00 0.00 0.00 1.2444 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.66
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 8.0sec 8.0sec 4.1sec 50.13% 0.00% 0.0 (0.0) 1.5

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.1s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.13%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Redirected Anima 16.1 0.0 48.3sec 18.6sec 58.7sec 84.25% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.0s / 290.1s
  • trigger_min/max:0.0s / 68.8s
  • trigger_pct:99.12%
  • duration_min/max:0.0s / 301.7s

Stack Uptimes

  • redirected_anima_1:20.01%
  • redirected_anima_2:10.10%
  • redirected_anima_3:3.08%
  • redirected_anima_4:0.68%
  • redirected_anima_5:0.12%
  • redirected_anima_6:0.01%
  • redirected_anima_7:0.00%
  • redirected_anima_8:17.03%
  • redirected_anima_9:19.88%
  • redirected_anima_10:9.65%
  • redirected_anima_11:2.95%
  • redirected_anima_12:0.65%
  • redirected_anima_13:0.13%
  • redirected_anima_14:0.03%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.86% 0.00% 0.0 (0.0) 5.2

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.8s
  • trigger_min/max:61.3s / 68.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • soul_rot_1:13.86%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.4s
  • trigger_min/max:180.0s / 187.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.4s
  • trigger_min/max:180.0s / 187.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.11% 11.51% 18.24% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
soul_fire Soul Shard 6.60 7.20 7.56% 1.09 0.70 8.89%
immolate Soul Shard 347.90 33.66 35.38% 0.10 1.13 3.25%
incinerate Soul Shard 44.77 11.15 11.72% 0.25 0.01 0.09%
conflagrate Soul Shard 36.95 28.28 29.73% 0.77 0.00 0.00%
mana_regen Mana 659.99 116008.82 100.00% 175.77 33911.56 22.62%
immolate_crits Soul Shard 33.68 3.26 3.43% 0.10 0.11 3.12%
incinerate_crits Soul Shard 10.50 1.05 1.10% 0.10 0.00 0.18%
infernal Soul Shard 120.00 10.53 11.07% 0.09 1.47 12.22%
pet - imp
energy_regen Energy 361.58 3565.87 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.06 388.62 33940.0 49232.5 47874.5 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Niya
cataclysm Mana 9.7 4856.2 500.0 500.4 49.2
channel_demonfire Mana 12.1 9041.0 750.0 750.5 35.3
chaos_bolt Soul Shard 21.7 43.4 2.0 2.0 12650.6
conflagrate Mana 36.9 18472.7 500.0 499.8 13.6
havoc Mana 9.7 9660.9 1000.0 999.7 0.0
immolate Mana 26.8 20068.4 750.0 749.6 25.1
incinerate Mana 44.8 44768.8 1000.0 1000.7 4.3
rain_of_fire Soul Shard 17.5 52.5 3.0 3.0 5430.7
soul_fire Mana 6.6 6596.9 1000.0 1180.9 23.8
soul_rot Mana 5.3 1313.7 250.0 249.7 77.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 93.4 3736.5 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Niya Damage Per Second
Count 624
Mean 9958.23
Minimum 9455.91
Maximum 10589.02
Spread ( max - min ) 1133.11
Range [ ( max - min ) / 2 * 100% ] 5.69%
Standard Deviation 224.0313
5th Percentile 9622.88
95th Percentile 10339.26
( 95th Percentile - 5th Percentile ) 716.38
Mean Distribution
Standard Deviation 8.9684
95.00% Confidence Interval ( 9940.65 - 9975.80 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1945
0.1 Scale Factor Error with Delta=300 429
0.05 Scale Factor Error with Delta=300 1714
0.01 Scale Factor Error with Delta=300 42846
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 624
Mean 5344.11
Minimum 5027.59
Maximum 5777.47
Spread ( max - min ) 749.89
Range [ ( max - min ) / 2 * 100% ] 7.02%
Standard Deviation 131.1167
5th Percentile 5155.06
95th Percentile 5569.36
( 95th Percentile - 5th Percentile ) 414.30
Mean Distribution
Standard Deviation 5.2489
95.00% Confidence Interval ( 5333.82 - 5354.39 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2313
0.1 Scale Factor Error with Delta=300 147
0.05 Scale Factor Error with Delta=300 588
0.01 Scale Factor Error with Delta=300 14676
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 624
Mean 9958.23
Minimum 9455.91
Maximum 10589.02
Spread ( max - min ) 1133.11
Range [ ( max - min ) / 2 * 100% ] 5.69%
Damage
NightFae_Niya Damage
Count 624
Mean 2621494.37
Minimum 2071865.84
Maximum 3169192.42
Spread ( max - min ) 1097326.59
Range [ ( max - min ) / 2 * 100% ] 20.93%
DTPS
NightFae_Niya Damage Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.37 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.76 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.29 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.28 soul_rot
F 12.05 channel_demonfire,if=dot.immolate.remains>cast_time
G 18.01 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.66 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.21 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.33 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.89 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.62 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.31 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.87 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.80 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.13 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGGDLKLLDKALLJFINQRRNOPGJLKFJLKAELLINQQPNQFGLGGKLLJKA9IQNQRRPNFGJLKLLLEAJKIRRQRNPF9GJKLJKLLAINQRQRNPFGLGJKMLLEDKA9FIQNQNPQDGKLLGFLAJKLIRNQPQRN9FEGGJKALKIQRQPRNFLJGKLLGGKJALINOQQNFLJGGEGKLL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E soul_rot Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.746 aoe F channel_demonfire Fluffy_Pillow 49623.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.941 cds M summon_infernal Fluffy_Pillow 49970.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot, redirected_anima(9)
0:05.948 aoe I havoc enemy2 49474.0/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot, redirected_anima(9)
0:06.953 havoc Q chaos_bolt Fluffy_Pillow 48976.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot, redirected_anima(9)
0:08.963 havoc N conflagrate Fluffy_Pillow 49981.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot, redirected_anima(9)
0:09.970 havoc Q chaos_bolt Fluffy_Pillow 49985.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot, redirected_anima(9)
0:11.376 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima(9)
0:12.381 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:13.389 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:14.796 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, redirected_anima(10)
0:15.803 havoc Q chaos_bolt Fluffy_Pillow 49960.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:17.210 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, redirected_anima(10)
0:18.217 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:19.221 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:21.661 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:22.667 aoe G immolate enemy2 49252.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:23.673 aoe G immolate enemy3 49005.0/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:24.679 aoe D rain_of_fire Fluffy_Pillow 48758.0/50000: 98% mana
3.3/5: 66% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:25.686 aoe L incinerate Fluffy_Pillow 49261.5/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:26.625 aoe K conflagrate Fluffy_Pillow 48731.0/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust, redirected_anima(10)
0:27.633 aoe L incinerate Fluffy_Pillow 48735.0/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:28.574 aoe L incinerate Fluffy_Pillow 48205.5/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust, redirected_anima(10)
0:29.913 aoe D rain_of_fire Fluffy_Pillow 47875.0/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust, redirected_anima(10)
0:30.919 aoe K conflagrate Fluffy_Pillow 48378.0/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust, redirected_anima(10)
0:31.926 default A cataclysm Fluffy_Pillow 48381.5/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:33.266 aoe L incinerate Fluffy_Pillow 48551.5/50000: 97% mana
2.1/5: 42% soul_shard
bloodlust, backdraft, redirected_anima
0:34.206 aoe L incinerate Fluffy_Pillow 48021.5/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima
0:35.545 aoe J rain_of_fire Fluffy_Pillow 47691.0/50000: 95% mana
3.2/5: 64% soul_shard
bloodlust, redirected_anima
0:36.552 aoe F channel_demonfire Fluffy_Pillow 48194.5/50000: 96% mana
0.5/5: 10% soul_shard
bloodlust, redirected_anima
0:38.813 aoe I havoc enemy2 48575.0/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust, redirected_anima
0:39.820 havoc N conflagrate Fluffy_Pillow 48078.5/50000: 96% mana
1.2/5: 24% soul_shard
bloodlust, redirected_anima
0:40.828 havoc Q chaos_bolt Fluffy_Pillow 48082.5/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust, backdraft, redirected_anima
0:42.234 havoc R incinerate Fluffy_Pillow 48785.5/50000: 98% mana
0.5/5: 10% soul_shard
0:43.973 havoc R incinerate Fluffy_Pillow 48655.0/50000: 97% mana
1.0/5: 20% soul_shard
0:45.713 havoc N conflagrate Fluffy_Pillow 48525.0/50000: 97% mana
1.8/5: 36% soul_shard
0:47.019 havoc O soul_fire Fluffy_Pillow 48678.0/50000: 97% mana
3.0/5: 60% soul_shard
backdraft
0:50.495 havoc P immolate Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.800 aoe G immolate enemy3 48904.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:53.105 aoe J rain_of_fire Fluffy_Pillow 48806.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:54.411 aoe L incinerate Fluffy_Pillow 49459.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
0:55.633 aoe K conflagrate Fluffy_Pillow 49003.5/50000: 98% mana
2.6/5: 52% soul_shard
0:56.939 aoe F channel_demonfire Fluffy_Pillow 49156.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
0:59.711 aoe J rain_of_fire Fluffy_Pillow 49792.5/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:01.018 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
1:02.238 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
1:03.544 default A cataclysm Fluffy_Pillow 49155.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
1:05.286 aoe E soul_rot Fluffy_Pillow 49503.0/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
1:06.592 aoe L incinerate Fluffy_Pillow 49752.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft, soul_rot
1:07.811 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
soul_rot, redirected_anima(8)
1:09.553 aoe I havoc enemy2 48873.0/50000: 98% mana
2.8/5: 56% soul_shard
soul_rot, redirected_anima(9)
1:10.859 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
3.0/5: 60% soul_shard
soul_rot, redirected_anima(9)
1:12.165 havoc Q chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
4.2/5: 84% soul_shard
backdraft, soul_rot, redirected_anima(9)
1:13.992 havoc Q chaos_bolt Fluffy_Pillow 49592.5/50000: 99% mana
2.5/5: 50% soul_shard
soul_rot, redirected_anima(9)
1:16.602 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
redirected_anima(9)
1:17.908 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
redirected_anima(10)
1:19.214 havoc Q chaos_bolt Fluffy_Pillow 49405.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, redirected_anima(10)
1:21.040 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
redirected_anima(10)
1:23.761 aoe G immolate enemy3 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
redirected_anima(10)
1:25.068 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.1/5: 22% soul_shard
redirected_anima(10)
1:26.809 aoe G immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
redirected_anima(10)
1:28.115 aoe G immolate enemy2 48905.5/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima(10)
1:29.420 aoe K conflagrate Fluffy_Pillow 48808.0/50000: 98% mana
1.8/5: 36% soul_shard
redirected_anima(10)
1:30.727 aoe L incinerate Fluffy_Pillow 48961.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, redirected_anima(10)
1:31.948 aoe L incinerate Fluffy_Pillow 48572.0/50000: 97% mana
2.9/5: 58% soul_shard
redirected_anima(10)
1:33.689 aoe J rain_of_fire Fluffy_Pillow 48442.5/50000: 97% mana
3.3/5: 66% soul_shard
redirected_anima(10)
1:34.995 aoe K conflagrate Fluffy_Pillow 49095.5/50000: 98% mana
0.5/5: 10% soul_shard
redirected_anima(10)
1:36.301 default A cataclysm Fluffy_Pillow 49248.5/50000: 98% mana
1.1/5: 22% soul_shard
backdraft, redirected_anima(10)
1:38.041 default 9 soul_fire Fluffy_Pillow 49502.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft, redirected_anima(2)
1:41.517 aoe I havoc enemy2 49001.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, redirected_anima(2)
1:42.825 havoc Q chaos_bolt Fluffy_Pillow 48655.5/50000: 97% mana
3.1/5: 62% soul_shard
backdraft, redirected_anima(2)
1:44.653 havoc N conflagrate Fluffy_Pillow 49569.5/50000: 99% mana
1.3/5: 26% soul_shard
redirected_anima(2)
1:45.959 havoc Q chaos_bolt Fluffy_Pillow 49722.5/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, redirected_anima(2)
1:47.785 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
redirected_anima
1:49.525 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
redirected_anima
1:51.266 havoc P immolate Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
redirected_anima
1:52.572 havoc N conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
2.0/5: 40% soul_shard
redirected_anima
1:53.880 aoe F channel_demonfire Fluffy_Pillow 48929.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, redirected_anima
1:56.656 aoe G immolate enemy3 49567.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft, redirected_anima
1:57.965 aoe J rain_of_fire Fluffy_Pillow 49253.5/50000: 99% mana
3.7/5: 74% soul_shard
backdraft, redirected_anima
1:59.273 aoe L incinerate Fluffy_Pillow 49907.5/50000: 100% mana
0.8/5: 16% soul_shard
backdraft, redirected_anima
2:00.493 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
redirected_anima
2:01.801 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft, redirected_anima
2:03.021 aoe L incinerate Fluffy_Pillow 48766.5/50000: 98% mana
2.2/5: 44% soul_shard
redirected_anima
2:04.758 aoe L incinerate Fluffy_Pillow 48635.0/50000: 97% mana
2.6/5: 52% soul_shard
redirected_anima
2:06.499 aoe E soul_rot Fluffy_Pillow 48505.5/50000: 97% mana
3.0/5: 60% soul_shard
2:07.894 default A cataclysm Fluffy_Pillow 48953.0/50000: 98% mana
3.3/5: 66% soul_shard
soul_rot
2:09.777 aoe J rain_of_fire Fluffy_Pillow 49394.5/50000: 99% mana
3.4/5: 68% soul_shard
soul_rot, redirected_anima(8)
2:11.083 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
soul_rot, redirected_anima(8)
2:12.389 aoe I havoc enemy2 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft, soul_rot, redirected_anima(8)
2:13.696 havoc R incinerate Fluffy_Pillow 49653.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft, soul_rot, redirected_anima(8)
2:14.915 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
soul_rot, redirected_anima(8)
2:16.655 havoc Q chaos_bolt Fluffy_Pillow 48872.0/50000: 98% mana
2.6/5: 52% soul_shard
redirected_anima(9)
2:19.263 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
redirected_anima(10)
2:21.004 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima(10)
2:22.313 havoc P immolate Fluffy_Pillow 49157.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, redirected_anima(10)
2:23.618 aoe F channel_demonfire Fluffy_Pillow 49059.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima(10)
2:26.403 default 9 soul_fire Fluffy_Pillow 49702.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, redirected_anima(10)
2:29.991 aoe G immolate enemy3 49002.0/50000: 98% mana
4.7/5: 94% soul_shard
backdraft, redirected_anima(11)
2:31.299 aoe J rain_of_fire Fluffy_Pillow 48906.0/50000: 98% mana
5.0/5: 100% soul_shard
redirected_anima(11)
2:32.606 aoe K conflagrate Fluffy_Pillow 49559.5/50000: 99% mana
2.1/5: 42% soul_shard
redirected_anima(11)
2:33.914 aoe L incinerate Fluffy_Pillow 49713.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima(11)
2:35.134 aoe J rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
redirected_anima(11)
2:36.438 aoe K conflagrate Fluffy_Pillow 49654.5/50000: 99% mana
0.4/5: 8% soul_shard
redirected_anima(11)
2:37.746 aoe L incinerate Fluffy_Pillow 49808.5/50000: 100% mana
1.0/5: 20% soul_shard
backdraft, redirected_anima(11)
2:38.966 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
redirected_anima(3)
2:40.706 default A cataclysm Fluffy_Pillow 48872.5/50000: 98% mana
1.7/5: 34% soul_shard
redirected_anima(3)
2:42.446 aoe I havoc enemy2 49242.5/50000: 98% mana
2.0/5: 40% soul_shard
redirected_anima(3)
2:43.755 havoc N conflagrate Fluffy_Pillow 48897.0/50000: 98% mana
2.1/5: 42% soul_shard
redirected_anima(4)
2:45.063 havoc Q chaos_bolt Fluffy_Pillow 49051.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, redirected_anima(4)
2:46.891 havoc R incinerate Fluffy_Pillow 49965.0/50000: 100% mana
1.6/5: 32% soul_shard
redirected_anima(3)
2:48.632 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
redirected_anima(4)
2:51.242 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
redirected_anima(3)
2:52.982 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
redirected_anima(3)
2:54.288 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, redirected_anima(3)
2:55.593 aoe F channel_demonfire Fluffy_Pillow 49057.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, redirected_anima(3)
2:58.401 aoe G immolate enemy2 49711.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, redirected_anima(3)
2:59.707 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima(2)
3:00.927 aoe G immolate enemy3 48862.0/50000: 98% mana
3.2/5: 64% soul_shard
redirected_anima(2)
3:02.234 aoe J rain_of_fire Fluffy_Pillow 48765.5/50000: 98% mana
3.3/5: 66% soul_shard
redirected_anima(2)
3:03.540 aoe K conflagrate Fluffy_Pillow 49418.5/50000: 99% mana
0.5/5: 10% soul_shard
redirected_anima(2)
3:04.847 cds M summon_infernal Fluffy_Pillow 49572.0/50000: 99% mana
1.1/5: 22% soul_shard
backdraft, redirected_anima(2)
3:06.247 aoe L incinerate Fluffy_Pillow 49272.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, redirected_anima(2)
3:07.467 aoe L incinerate Fluffy_Pillow 48882.0/50000: 98% mana
2.1/5: 42% soul_shard
redirected_anima(2)
3:09.207 aoe E soul_rot Fluffy_Pillow 48752.0/50000: 98% mana
2.8/5: 56% soul_shard
redirected_anima(2)
3:10.514 aoe D rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.4/5: 68% soul_shard
soul_rot, redirected_anima(2)
3:11.819 aoe K conflagrate Fluffy_Pillow 49808.0/50000: 100% mana
0.7/5: 14% soul_shard
soul_rot, redirected_anima(10)
3:13.126 default A cataclysm Fluffy_Pillow 49961.5/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, soul_rot, redirected_anima(9)
3:14.866 default 9 soul_fire Fluffy_Pillow 49502.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, soul_rot, redirected_anima(9)
3:18.467 aoe F channel_demonfire Fluffy_Pillow 49003.5/50000: 98% mana
4.4/5: 88% soul_shard
backdraft, soul_rot, redirected_anima(8)
3:21.272 aoe I havoc enemy2 49656.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, redirected_anima(8)
3:22.577 havoc Q chaos_bolt Fluffy_Pillow 49308.5/50000: 99% mana
5.0/5: 100% soul_shard
redirected_anima(8)
3:25.186 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(8)
3:26.492 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft, redirected_anima(8)
3:28.321 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(8)
3:29.628 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft, redirected_anima(8)
3:30.935 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.9/5: 98% soul_shard
backdraft, redirected_anima(8)
3:32.762 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(8)
3:34.070 aoe G immolate enemy3 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
redirected_anima(8)
3:35.377 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
redirected_anima(8)
3:36.884 aoe L incinerate Fluffy_Pillow 49506.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft, redirected_anima(8)
3:38.103 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
redirected_anima(8)
3:39.844 aoe G immolate enemy2 48872.5/50000: 98% mana
2.3/5: 46% soul_shard
redirected_anima(8)
3:41.152 aoe F channel_demonfire Fluffy_Pillow 48776.5/50000: 98% mana
2.5/5: 50% soul_shard
3:43.891 aoe L incinerate Fluffy_Pillow 49396.0/50000: 99% mana
2.8/5: 56% soul_shard
3:45.631 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
3.2/5: 64% soul_shard
3:47.371 aoe J rain_of_fire Fluffy_Pillow 49372.0/50000: 99% mana
3.5/5: 70% soul_shard
3:48.678 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
3:49.985 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft
3:51.204 aoe I havoc enemy2 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
3:52.578 havoc R incinerate Fluffy_Pillow 48689.0/50000: 97% mana
1.8/5: 36% soul_shard
3:54.318 havoc N conflagrate Fluffy_Pillow 48559.0/50000: 97% mana
2.3/5: 46% soul_shard
3:55.624 havoc Q chaos_bolt Fluffy_Pillow 48712.0/50000: 97% mana
3.7/5: 74% soul_shard
backdraft, redirected_anima
3:57.452 havoc P immolate Fluffy_Pillow 49626.0/50000: 99% mana
1.9/5: 38% soul_shard
redirected_anima
3:58.758 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
2.1/5: 42% soul_shard
redirected_anima
4:01.368 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
redirected_anima
4:03.107 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.0/5: 20% soul_shard
redirected_anima
4:04.414 default 9 soul_fire Fluffy_Pillow 49155.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, redirected_anima
4:07.893 aoe F channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft, redirected_anima
4:10.717 aoe E soul_rot Fluffy_Pillow 49665.0/50000: 99% mana
3.8/5: 76% soul_shard
backdraft, redirected_anima
4:12.023 aoe G immolate enemy2 49752.0/50000: 100% mana
4.0/5: 80% soul_shard
backdraft, soul_rot, redirected_anima
4:13.329 aoe G immolate enemy3 49252.0/50000: 99% mana
4.1/5: 82% soul_shard
soul_rot, redirected_anima(9)
4:14.635 aoe J rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
4.2/5: 84% soul_shard
soul_rot, redirected_anima(9)
4:15.941 aoe K conflagrate Fluffy_Pillow 49808.0/50000: 100% mana
1.3/5: 26% soul_shard
soul_rot, redirected_anima(9)
4:17.248 default A cataclysm Fluffy_Pillow 49961.5/50000: 100% mana
2.0/5: 40% soul_shard
backdraft, soul_rot, redirected_anima(9)
4:19.107 aoe L incinerate Fluffy_Pillow 49502.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, soul_rot, redirected_anima(9)
4:20.327 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
redirected_anima(9)
4:21.631 aoe I havoc enemy2 49154.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, redirected_anima(9)
4:22.937 havoc Q chaos_bolt Fluffy_Pillow 48807.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, redirected_anima(9)
4:24.764 havoc R incinerate Fluffy_Pillow 49721.0/50000: 99% mana
1.6/5: 32% soul_shard
redirected_anima(8)
4:26.505 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
redirected_anima(8)
4:29.116 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
redirected_anima(8)
4:30.423 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
redirected_anima(8)
4:32.163 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
redirected_anima(8)
4:33.469 aoe F channel_demonfire Fluffy_Pillow 49155.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, redirected_anima(8)
4:36.166 aoe L incinerate Fluffy_Pillow 49753.5/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima(8)
4:37.384 aoe J rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
3.4/5: 68% soul_shard
redirected_anima(8)
4:38.690 aoe G immolate enemy3 49654.5/50000: 99% mana
0.6/5: 12% soul_shard
redirected_anima(8)
4:39.996 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
redirected_anima(8)
4:41.302 aoe L incinerate Fluffy_Pillow 49405.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, redirected_anima(8)
4:42.520 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.9/5: 38% soul_shard
4:44.262 aoe G immolate Fluffy_Pillow 48872.5/50000: 98% mana
2.2/5: 44% soul_shard
4:45.568 aoe G immolate enemy2 48775.5/50000: 98% mana
2.4/5: 48% soul_shard
4:46.876 aoe K conflagrate Fluffy_Pillow 48679.5/50000: 97% mana
2.5/5: 50% soul_shard
4:48.181 aoe J rain_of_fire Fluffy_Pillow 48832.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
4:49.488 default A cataclysm Fluffy_Pillow 49485.5/50000: 99% mana
0.3/5: 6% soul_shard
backdraft
4:51.230 aoe L incinerate Fluffy_Pillow 49503.0/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
4:52.448 aoe I havoc enemy2 49001.5/50000: 98% mana
1.0/5: 20% soul_shard
4:53.754 havoc N conflagrate Fluffy_Pillow 48654.5/50000: 97% mana
1.3/5: 26% soul_shard
4:55.061 havoc O soul_fire Fluffy_Pillow 48808.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:58.539 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
5:00.367 havoc Q chaos_bolt Fluffy_Pillow 49916.5/50000: 100% mana
3.0/5: 60% soul_shard
5:02.976 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
redirected_anima
5:04.282 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft, redirected_anima
5:07.006 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
backdraft, redirected_anima
5:08.226 aoe J rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
redirected_anima
5:09.534 aoe G immolate enemy2 49656.5/50000: 99% mana
0.3/5: 6% soul_shard
redirected_anima
5:10.840 aoe G immolate Fluffy_Pillow 49252.0/50000: 99% mana
0.6/5: 12% soul_shard
redirected_anima
5:12.148 aoe E soul_rot Fluffy_Pillow 49156.0/50000: 98% mana
0.7/5: 14% soul_shard
redirected_anima
5:13.455 aoe G immolate enemy3 49559.5/50000: 99% mana
1.0/5: 20% soul_shard
soul_rot, redirected_anima
5:14.761 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
soul_rot, redirected_anima(9)
5:16.068 aoe L incinerate Fluffy_Pillow 49405.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft, soul_rot, redirected_anima(9)
5:17.286 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.1/5: 42% soul_shard
soul_rot, redirected_anima(9)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Niya"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=322721/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Nadjia : 9723 dps, 5192 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9722.6 9722.6 16.6 / 0.171% 800.7 / 8.2% 20.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
417.7 414.3 Mana 0.00% 38.8 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 9723
Cataclysm 774 8.0% 9.7 32.29sec 23902 14337 Direct 29.2 6698 13408 7970 18.9%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.73 29.19 0.00 0.00 1.6672 0.0000 232587.20 232587.20 0.00% 14336.88 14336.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 23.67 14 33 6697.81 6141 7261 6697.56 6475 6884 158561 158561 0.00%
crit 18.91% 5.52 0 12 13407.86 12284 14521 13312.20 0 14521 74026 74026 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.78
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1086) 0.0% (11.2%) 12.9 23.91sec 25189 9495

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.93 0.00 193.35 0.00 2.6530 0.1606 0.00 0.00 0.00% 9494.85 9494.85

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.93
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1086 11.2% 0.0 0.00sec 0 0 Direct 580.1 471 944 562 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 580.05 0.00 0.00 0.0000 0.0000 325758.85 325758.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 468.44 341 607 470.56 263 976 470.59 450 494 220421 220421 0.00%
crit 19.24% 111.61 64 160 943.51 525 1952 943.71 817 1091 105338 105338 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1365 (1845) 14.0% (19.0%) 22.8 12.80sec 24291 12501 Direct 45.3 (90.0) 0 9034 9034 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.76 45.27 0.00 0.00 1.9431 0.0000 408919.21 408919.21 0.00% 12501.38 12501.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.27 30 60 9034.07 5862 12241 9033.30 8841 9247 408919 408919 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.87
  • if_expr:cast_time<havoc_remains
    Internal Combustion 481 4.9% 44.8 12.82sec 3215 0 Direct 44.8 2692 5388 3215 19.4%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.77 44.77 0.00 0.00 0.0000 0.0000 143941.71 143941.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 36.08 20 49 2691.62 1 3715 2692.41 2427 2860 97107 97107 0.00%
crit 19.41% 8.69 1 18 5388.16 7 7430 5396.02 3969 7262 46835 46835 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 819 8.4% 37.9 7.80sec 6481 5295 Direct 56.7 3636 7280 4329 19.0%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.90 56.75 0.00 0.00 1.2240 0.0000 245621.84 245621.84 0.00% 5294.72 5294.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.00% 45.96 31 66 3636.00 2047 5042 3637.32 3385 3939 167140 167140 0.00%
crit 19.00% 10.78 2 19 7280.26 4096 10084 7272.96 5465 8708 78482 78482 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:19.04
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.85
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1651 17.0% 28.3 10.09sec 17496 14179 Direct 35.7 1538 3084 1836 19.2%
Periodic 356.5 1013 2025 1207 19.2% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.34 35.74 356.50 356.50 1.2340 2.4239 495817.46 495817.46 0.00% 551.48 14179.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 28.87 16 41 1538.26 819 2017 1537.64 1407 1662 44386 44386 0.00%
crit 19.22% 6.87 1 16 3083.91 1640 4033 3091.83 1845 3892 21186 21186 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.82% 288.14 220 353 1012.67 0 1261 1012.75 993 1033 291791 291791 0.00%
crit 19.18% 68.36 38 101 2025.28 3 2521 2025.67 1911 2144 138454 138454 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.91
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.55
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (232) 0.0% (2.4%) 4.7 65.23sec 14850 9496

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.68 0.00 0.00 0.00 1.5639 0.0000 0.00 0.00 0.00% 9496.48 9496.48

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.73
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.9 558 1116 664 19.0%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.88 0.00 0.00 0.0000 0.0000 9217.21 9217.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.04% 11.25 4 17 558.02 558 558 558.02 558 558 6279 6279 0.00%
crit 18.96% 2.63 0 8 1116.04 1116 1116 1039.14 0 1116 2939 2939 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 201 2.1% 0.0 0.00sec 0 0 Periodic 106.3 476 950 567 19.2% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 106.26 106.26 0.0000 1.5422 60249.54 60249.54 0.00% 367.64 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.77% 85.83 64 115 475.79 38 488 475.76 453 486 40829 40829 0.00%
crit 19.23% 20.44 8 32 950.27 76 977 950.08 828 977 19421 19421 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 595 6.1% 43.2 6.42sec 4153 2922 Direct 54.3 (54.3) 2774 5535 3303 19.1% (19.1%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.16 54.28 0.00 0.00 1.4214 0.0000 179258.81 179258.81 0.00% 2921.81 2921.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 43.89 24 63 2773.80 1319 3426 2775.65 2572 3009 121753 121753 0.00%
crit 19.14% 10.39 3 21 5535.03 2637 6852 5538.26 3943 6637 57506 57506 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.90
    havoc
    [R]:11.53
  • if_expr:cast_time<havoc_remains
Rain of Fire 891 9.2% 17.1 16.98sec 15637 12741 Periodic 405.2 553 1106 660 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.10 0.00 0.00 405.23 1.2273 0.0000 267405.97 267405.97 0.00% 12740.90 12740.90
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.64% 326.78 220 463 552.85 507 599 552.87 547 560 180663 180663 0.00%
crit 19.36% 78.45 46 112 1105.73 1013 1198 1105.69 1087 1124 86743 86743 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.33
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.75
Soul Fire 514 5.3% 5.6 49.65sec 27791 8046 Direct 7.7 16896 33747 20094 19.0%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.56 7.68 0.00 0.00 3.4541 0.0000 154499.64 154499.64 0.00% 8046.02 8046.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.98% 6.22 2 10 16895.58 8626 21175 16937.61 14386 20255 105140 105140 0.00%
crit 19.02% 1.46 0 6 33746.75 17438 42326 26381.19 0 42320 49360 49360 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.46
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.19
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.72sec 12008 10388 Direct 6.0 3348 6696 4000 19.6%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24016.43 24016.43 0.00% 10387.73 10387.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 4.83 1 6 3348.13 3348 3348 3348.13 3348 3348 16161 16161 0.00%
crit 19.55% 1.17 0 5 6696.27 6696 6696 4839.77 0 6696 7855 7855 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3508 / 710
Immolation 3243 6.7% 39.0 5.50sec 4989 0 Direct 117.0 1395 2790 1663 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194572.34 194572.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 94.53 81 106 1395.06 1395 1395 1395.06 1395 1395 131871 131871 0.00%
crit 19.21% 22.47 11 36 2790.11 2790 2790 2790.11 2790 2790 62702 62702 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.26sec 389 270 Direct 41.0 326 651 388 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15930.15 22754.62 29.99% 270.44 270.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 33.07 24 40 325.55 326 326 325.55 326 326 10765 15377 29.99%
crit 19.35% 7.93 1 17 651.10 651 651 651.10 651 651 5165 7378 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 525 / 525
Firebolt 525 5.4% 95.3 3.15sec 1653 1155 Direct 94.6 1395 2790 1666 19.4%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.34 94.62 0.00 0.00 1.4309 0.0000 157594.41 157594.41 0.00% 1155.16 1155.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 76.28 54 100 1395.06 1395 1395 1395.06 1395 1395 106411 106411 0.00%
crit 19.39% 18.34 7 34 2790.11 2790 2790 2790.11 2790 2790 51183 51183 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:95.77
Simple Action Stats Execute Interval
Venthyr_Nadjia
Havoc 9.7 32.22sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 0.00 0.00 0.00 1.2225 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.65
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.9 0.0 7.8sec 7.8sec 4.3sec 53.69% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.3s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:53.69%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.10% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 10.0s

Stack Uptimes

  • euphoria_1:11.10%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 145.4 78.0sec 2.0sec 67.1sec 97.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.90%
  • thrill_seeker_3:2.90%
  • thrill_seeker_4:2.89%
  • thrill_seeker_5:2.87%
  • thrill_seeker_6:2.85%
  • thrill_seeker_7:2.83%
  • thrill_seeker_8:2.81%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.76%
  • thrill_seeker_11:2.74%
  • thrill_seeker_12:2.71%
  • thrill_seeker_13:2.69%
  • thrill_seeker_14:2.67%
  • thrill_seeker_15:2.65%
  • thrill_seeker_16:2.64%
  • thrill_seeker_17:2.61%
  • thrill_seeker_18:2.59%
  • thrill_seeker_19:2.57%
  • thrill_seeker_20:2.55%
  • thrill_seeker_21:2.52%
  • thrill_seeker_22:2.50%
  • thrill_seeker_23:2.48%
  • thrill_seeker_24:2.45%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.41%
  • thrill_seeker_27:2.40%
  • thrill_seeker_28:2.39%
  • thrill_seeker_29:2.38%
  • thrill_seeker_30:2.36%
  • thrill_seeker_31:2.35%
  • thrill_seeker_32:2.34%
  • thrill_seeker_33:2.33%
  • thrill_seeker_34:2.32%
  • thrill_seeker_35:2.31%
  • thrill_seeker_36:2.29%
  • thrill_seeker_37:2.28%
  • thrill_seeker_38:2.27%
  • thrill_seeker_39:2.26%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.8sec 180.8sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.8sec 180.8sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.63% 6.99% 14.57% 0.8s 0.0s 6.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
soul_fire Soul Shard 6.57 7.27 7.57% 1.11 0.47 6.12%
immolate Soul Shard 356.46 34.46 35.90% 0.10 1.19 3.33%
incinerate Soul Shard 43.17 10.91 11.37% 0.25 0.01 0.08%
conflagrate Soul Shard 37.89 28.37 29.55% 0.75 0.00 0.00%
mana_regen Mana 685.57 124494.41 100.00% 181.59 25422.52 16.96%
immolate_crits Soul Shard 34.18 3.31 3.45% 0.10 0.11 3.23%
incinerate_crits Soul Shard 10.40 1.04 1.08% 0.10 0.00 0.02%
infernal Soul Shard 120.00 10.64 11.08% 0.09 1.36 11.35%
pet - imp
energy_regen Energy 372.50 3642.67 100.00% 9.78 22.74 0.62%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 414.33 417.73 25447.2 48977.4 46938.5 50000.0
Soul Shard 4.0 0.32 0.32 3.1 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
cataclysm Mana 9.7 4868.8 500.0 500.3 47.8
channel_demonfire Mana 12.9 9693.8 750.0 749.6 33.6
chaos_bolt Soul Shard 22.7 45.5 2.0 2.0 12151.6
conflagrate Mana 37.9 18946.1 500.0 499.9 13.0
havoc Mana 9.7 9653.1 1000.0 1000.3 0.0
immolate Mana 28.3 21249.6 750.0 749.9 23.3
impending_catastrophe Mana 4.7 9371.9 2000.0 2003.4 7.4
incinerate Mana 43.2 43170.3 1000.0 1000.2 4.2
rain_of_fire Soul Shard 17.1 51.3 3.0 3.0 5216.4
soul_fire Mana 6.6 6567.2 1000.0 1181.3 23.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 95.3 3813.4 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Venthyr_Nadjia Damage Per Second
Count 624
Mean 9722.64
Minimum 9178.62
Maximum 10362.50
Spread ( max - min ) 1183.88
Range [ ( max - min ) / 2 * 100% ] 6.09%
Standard Deviation 211.9421
5th Percentile 9397.46
95th Percentile 10081.98
( 95th Percentile - 5th Percentile ) 684.52
Mean Distribution
Standard Deviation 8.4845
95.00% Confidence Interval ( 9706.02 - 9739.27 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1826
0.1 Scale Factor Error with Delta=300 384
0.05 Scale Factor Error with Delta=300 1534
0.01 Scale Factor Error with Delta=300 38346
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 624
Mean 5192.47
Minimum 4866.90
Maximum 5584.57
Spread ( max - min ) 717.67
Range [ ( max - min ) / 2 * 100% ] 6.91%
Standard Deviation 121.6702
5th Percentile 4999.60
95th Percentile 5407.70
( 95th Percentile - 5th Percentile ) 408.10
Mean Distribution
Standard Deviation 4.8707
95.00% Confidence Interval ( 5182.93 - 5202.02 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2110
0.1 Scale Factor Error with Delta=300 127
0.05 Scale Factor Error with Delta=300 506
0.01 Scale Factor Error with Delta=300 12638
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 624
Mean 9722.64
Minimum 9178.62
Maximum 10362.50
Spread ( max - min ) 1183.88
Range [ ( max - min ) / 2 * 100% ] 6.09%
Damage
Venthyr_Nadjia Damage
Count 624
Mean 2547293.86
Minimum 2028557.72
Maximum 3066550.64
Spread ( max - min ) 1037992.92
Range [ ( max - min ) / 2 * 100% ] 20.37%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.46 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.78 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.33 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.93 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.91 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.65 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.75 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 19.04 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.73 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.90 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.85 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.19 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.55 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.87 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.53 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDKLJLJDLALJEHQQRNOFFIFJIELJLALLHNQQPNQELFJFFKLIJL9AEHNQQNPQLLJFLEFFIJALHQRNQPRN9EFIJKFLIJAHRRQRNQPEFJLFLMDJLLDA9EHQNQNPQNDFLKFEIAJLJLHQNPQRRRNEFFI9FIAJLHNQRQPNELIFJKLLJLLAHQNQPOEIJLFJILLLL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.008 cds M summon_infernal Fluffy_Pillow 49754.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, thrill_seeker(3)
0:05.014 aoe H havoc enemy2 49257.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, thrill_seeker(3)
0:06.020 havoc Q chaos_bolt Fluffy_Pillow 48760.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, thrill_seeker(4)
0:08.029 havoc N conflagrate Fluffy_Pillow 49764.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(5)
0:09.034 havoc Q chaos_bolt Fluffy_Pillow 49767.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(5)
0:10.442 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, thrill_seeker(6)
0:11.447 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft, thrill_seeker(6)
0:12.453 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, thrill_seeker(7)
0:13.859 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, thrill_seeker(7)
0:14.865 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, thrill_seeker(8)
0:16.271 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, thrill_seeker(9)
0:17.279 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft, thrill_seeker(9)
0:18.284 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft, thrill_seeker(10)
0:20.588 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:21.594 aoe F immolate enemy2 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:22.600 aoe F immolate enemy3 49005.0/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:23.606 aoe D rain_of_fire Fluffy_Pillow 48758.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:24.614 aoe K impending_catastrophe Fluffy_Pillow 49262.0/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft, thrill_seeker(13)
0:25.954 aoe L incinerate Fluffy_Pillow 47932.0/50000: 96% mana
0.9/5: 18% soul_shard
bloodlust, backdraft, thrill_seeker(13)
0:26.893 aoe J conflagrate Fluffy_Pillow 47401.5/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust, thrill_seeker(14)
0:27.900 aoe L incinerate Fluffy_Pillow 47405.0/50000: 95% mana
2.3/5: 46% soul_shard
bloodlust, backdraft, thrill_seeker(14)
0:28.841 aoe J conflagrate Fluffy_Pillow 46875.5/50000: 94% mana
2.9/5: 58% soul_shard
bloodlust, thrill_seeker(15)
0:29.849 aoe D rain_of_fire Fluffy_Pillow 46879.5/50000: 94% mana
3.8/5: 76% soul_shard
bloodlust, backdraft, thrill_seeker(15)
0:30.855 aoe L incinerate Fluffy_Pillow 47382.5/50000: 95% mana
1.1/5: 22% soul_shard
bloodlust, backdraft, thrill_seeker(16)
0:31.795 default A cataclysm Fluffy_Pillow 46852.5/50000: 94% mana
1.9/5: 38% soul_shard
bloodlust, thrill_seeker(16)
0:33.135 aoe L incinerate Fluffy_Pillow 47022.5/50000: 94% mana
2.3/5: 46% soul_shard
bloodlust, thrill_seeker(17)
0:34.477 aoe J conflagrate Fluffy_Pillow 46693.5/50000: 93% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(18)
0:35.650 aoe E channel_demonfire Fluffy_Pillow 46780.0/50000: 94% mana
3.7/5: 74% soul_shard
bloodlust, backdraft, thrill_seeker(18)
0:37.887 aoe H havoc enemy2 47148.5/50000: 94% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(19)
0:38.894 havoc Q chaos_bolt Fluffy_Pillow 46652.0/50000: 93% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, thrill_seeker(20)
0:40.301 havoc Q chaos_bolt Fluffy_Pillow 47355.5/50000: 95% mana
2.5/5: 50% soul_shard
bloodlust, thrill_seeker(21)
0:42.310 havoc R incinerate Fluffy_Pillow 48360.0/50000: 97% mana
0.9/5: 18% soul_shard
thrill_seeker(22)
0:44.051 havoc N conflagrate Fluffy_Pillow 48230.5/50000: 96% mana
1.4/5: 28% soul_shard
thrill_seeker(23)
0:45.357 havoc O soul_fire Fluffy_Pillow 48383.5/50000: 97% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(23)
0:48.833 aoe F immolate enemy2 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(25)
0:50.140 aoe F immolate Fluffy_Pillow 48905.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(26)
0:51.446 aoe I rain_of_fire Fluffy_Pillow 48808.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(26)
0:52.753 aoe F immolate enemy3 49461.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(27)
0:54.060 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.4/5: 48% soul_shard
thrill_seeker(28)
0:55.367 aoe I rain_of_fire Fluffy_Pillow 49406.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(28)
0:56.672 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft, thrill_seeker(29)
0:59.552 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, thrill_seeker(30)
1:00.770 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.9/5: 18% soul_shard
thrill_seeker(31)
1:02.076 aoe L incinerate Fluffy_Pillow 49154.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft, thrill_seeker(32)
1:03.296 default A cataclysm Fluffy_Pillow 48764.5/50000: 98% mana
1.9/5: 38% soul_shard
thrill_seeker(32)
1:05.035 aoe L incinerate Fluffy_Pillow 49134.0/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(33)
1:06.775 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
thrill_seeker(34)
1:08.515 aoe H havoc enemy2 48872.0/50000: 98% mana
3.0/5: 60% soul_shard
thrill_seeker(35)
1:09.822 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
3.2/5: 64% soul_shard
thrill_seeker(35)
1:11.128 havoc Q chaos_bolt Fluffy_Pillow 48678.5/50000: 97% mana
4.4/5: 88% soul_shard
backdraft, thrill_seeker(36)
1:12.956 havoc Q chaos_bolt Fluffy_Pillow 49592.5/50000: 99% mana
2.7/5: 54% soul_shard
thrill_seeker(37)
1:15.566 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
thrill_seeker(38)
1:16.873 havoc N conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.3/5: 26% soul_shard
thrill_seeker(39)
1:18.181 havoc Q chaos_bolt Fluffy_Pillow 49406.5/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, euphoria
1:19.705 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
euphoria
1:22.037 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
thrill_seeker(3), euphoria
1:23.486 aoe F immolate enemy3 49001.0/50000: 98% mana
1.3/5: 26% soul_shard
thrill_seeker(3), euphoria
1:24.577 aoe J conflagrate Fluffy_Pillow 48796.5/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(4), euphoria
1:25.669 aoe F immolate Fluffy_Pillow 48842.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(4), euphoria
1:26.759 aoe F immolate enemy2 48637.5/50000: 97% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(5), euphoria
1:27.848 aoe K impending_catastrophe Fluffy_Pillow 48432.0/50000: 97% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(5), euphoria
1:29.300 aoe L incinerate Fluffy_Pillow 47158.0/50000: 94% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(6)
1:30.520 aoe I rain_of_fire Fluffy_Pillow 46768.0/50000: 94% mana
3.3/5: 66% soul_shard
thrill_seeker(7)
1:31.828 aoe J conflagrate Fluffy_Pillow 47422.0/50000: 95% mana
0.4/5: 8% soul_shard
thrill_seeker(7)
1:33.137 aoe L incinerate Fluffy_Pillow 47576.5/50000: 95% mana
1.1/5: 22% soul_shard
backdraft, thrill_seeker(8)
1:34.356 default 9 soul_fire Fluffy_Pillow 47186.0/50000: 94% mana
1.4/5: 28% soul_shard
thrill_seeker(9)
1:37.834 default A cataclysm Fluffy_Pillow 47925.0/50000: 96% mana
2.9/5: 58% soul_shard
thrill_seeker(10)
1:39.575 aoe E channel_demonfire Fluffy_Pillow 48295.5/50000: 97% mana
3.0/5: 60% soul_shard
thrill_seeker(11)
1:42.669 aoe H havoc enemy2 49092.5/50000: 98% mana
3.3/5: 66% soul_shard
thrill_seeker(13)
1:43.975 havoc N conflagrate Fluffy_Pillow 48745.5/50000: 97% mana
3.5/5: 70% soul_shard
thrill_seeker(13)
1:45.280 havoc Q chaos_bolt Fluffy_Pillow 48898.0/50000: 98% mana
4.8/5: 96% soul_shard
backdraft, thrill_seeker(14)
1:47.108 havoc Q chaos_bolt Fluffy_Pillow 49812.0/50000: 100% mana
2.9/5: 58% soul_shard
thrill_seeker(15)
1:49.719 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
thrill_seeker(16)
1:51.025 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(17)
1:52.332 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(18)
1:54.158 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
thrill_seeker(19)
1:55.898 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(19)
1:57.639 aoe J conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
thrill_seeker(20)
1:58.946 aoe F immolate enemy3 49026.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(21)
2:00.252 aoe L incinerate Fluffy_Pillow 48929.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(22)
2:01.470 aoe E channel_demonfire Fluffy_Pillow 48538.0/50000: 97% mana
3.1/5: 62% soul_shard
thrill_seeker(22)
2:04.374 aoe F immolate enemy2 49240.0/50000: 98% mana
3.4/5: 68% soul_shard
thrill_seeker(24)
2:05.682 aoe F immolate Fluffy_Pillow 49144.0/50000: 98% mana
3.5/5: 70% soul_shard
thrill_seeker(24)
2:06.988 aoe I rain_of_fire Fluffy_Pillow 49047.0/50000: 98% mana
3.7/5: 74% soul_shard
thrill_seeker(25)
2:08.293 aoe J conflagrate Fluffy_Pillow 49699.5/50000: 99% mana
0.8/5: 16% soul_shard
thrill_seeker(26)
2:09.599 default A cataclysm Fluffy_Pillow 49852.5/50000: 100% mana
1.5/5: 30% soul_shard
backdraft, thrill_seeker(26)
2:11.338 aoe L incinerate Fluffy_Pillow 49501.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft, thrill_seeker(27)
2:12.558 aoe H havoc enemy2 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(28)
2:13.975 havoc Q chaos_bolt Fluffy_Pillow 48711.0/50000: 97% mana
2.2/5: 44% soul_shard
thrill_seeker(28)
2:16.585 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
thrill_seeker(30)
2:18.326 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
thrill_seeker(31)
2:19.632 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(31)
2:21.460 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
thrill_seeker(32)
2:22.767 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
thrill_seeker(33)
2:24.507 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(34)
2:25.814 default 9 soul_fire Fluffy_Pillow 49155.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(34)
2:29.290 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft, thrill_seeker(36)
2:32.096 aoe F immolate enemy3 49654.5/50000: 99% mana
4.2/5: 84% soul_shard
backdraft, thrill_seeker(38)
2:33.403 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.5/5: 90% soul_shard
backdraft, thrill_seeker(38)
2:34.710 aoe J conflagrate Fluffy_Pillow 49906.0/50000: 100% mana
1.6/5: 32% soul_shard
thrill_seeker(39)
2:36.017 aoe K impending_catastrophe Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft, euphoria
2:37.468 aoe F immolate enemy2 48002.0/50000: 96% mana
2.5/5: 50% soul_shard
backdraft, euphoria
2:38.557 aoe L incinerate Fluffy_Pillow 47796.5/50000: 96% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker, euphoria
2:39.573 aoe I rain_of_fire Fluffy_Pillow 47304.5/50000: 95% mana
3.0/5: 60% soul_shard
thrill_seeker, euphoria
2:40.661 aoe J conflagrate Fluffy_Pillow 47848.5/50000: 96% mana
0.1/5: 2% soul_shard
thrill_seeker(3), euphoria
2:41.751 default A cataclysm Fluffy_Pillow 47893.5/50000: 96% mana
0.8/5: 16% soul_shard
backdraft, thrill_seeker(3), euphoria
2:43.204 aoe H havoc enemy2 48120.0/50000: 96% mana
0.9/5: 18% soul_shard
backdraft, thrill_seeker(4), euphoria
2:44.291 havoc R incinerate Fluffy_Pillow 47663.5/50000: 95% mana
1.1/5: 22% soul_shard
backdraft, thrill_seeker(5), euphoria
2:45.308 havoc R incinerate Fluffy_Pillow 47172.0/50000: 94% mana
1.6/5: 32% soul_shard
thrill_seeker(5), euphoria
2:46.759 havoc Q chaos_bolt Fluffy_Pillow 46897.5/50000: 94% mana
2.2/5: 44% soul_shard
thrill_seeker(6)
2:49.367 havoc R incinerate Fluffy_Pillow 48201.5/50000: 96% mana
0.7/5: 14% soul_shard
thrill_seeker(7)
2:51.109 havoc N conflagrate Fluffy_Pillow 48072.5/50000: 96% mana
1.4/5: 28% soul_shard
thrill_seeker(8)
2:52.414 havoc Q chaos_bolt Fluffy_Pillow 48225.0/50000: 96% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker(9)
2:54.243 havoc P immolate Fluffy_Pillow 49139.5/50000: 98% mana
0.9/5: 18% soul_shard
thrill_seeker(10)
2:55.550 aoe E channel_demonfire Fluffy_Pillow 49043.0/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(10)
2:58.365 aoe F immolate enemy2 49700.5/50000: 99% mana
1.6/5: 32% soul_shard
thrill_seeker(12)
2:59.672 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.6/5: 32% soul_shard
thrill_seeker(12)
3:00.978 aoe L incinerate Fluffy_Pillow 49405.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(13)
3:02.200 aoe F immolate enemy3 49003.5/50000: 98% mana
2.5/5: 50% soul_shard
thrill_seeker(14)
3:03.506 aoe L incinerate Fluffy_Pillow 48906.5/50000: 98% mana
2.8/5: 56% soul_shard
thrill_seeker(14)
3:05.248 cds M summon_infernal Fluffy_Pillow 48777.5/50000: 98% mana
3.2/5: 64% soul_shard
thrill_seeker(15)
3:06.555 aoe D rain_of_fire Fluffy_Pillow 48431.0/50000: 97% mana
3.5/5: 70% soul_shard
thrill_seeker(16)
3:07.859 aoe J conflagrate Fluffy_Pillow 49083.0/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker(16)
3:09.166 aoe L incinerate Fluffy_Pillow 49236.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft, thrill_seeker(17)
3:10.385 aoe L incinerate Fluffy_Pillow 48846.0/50000: 98% mana
2.5/5: 50% soul_shard
thrill_seeker(18)
3:12.124 aoe D rain_of_fire Fluffy_Pillow 48715.5/50000: 97% mana
3.1/5: 62% soul_shard
thrill_seeker(19)
3:13.428 default A cataclysm Fluffy_Pillow 49367.5/50000: 99% mana
0.6/5: 12% soul_shard
thrill_seeker(19)
3:15.168 default 9 soul_fire Fluffy_Pillow 49502.0/50000: 99% mana
1.1/5: 22% soul_shard
thrill_seeker(20)
3:18.645 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.2/5: 64% soul_shard
thrill_seeker(22)
3:21.373 aoe H havoc enemy2 49616.0/50000: 99% mana
4.1/5: 82% soul_shard
thrill_seeker(23)
3:22.680 havoc Q chaos_bolt Fluffy_Pillow 49269.5/50000: 99% mana
4.4/5: 88% soul_shard
thrill_seeker(24)
3:25.287 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(25)
3:26.592 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft, thrill_seeker(26)
3:28.419 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(27)
3:29.727 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, thrill_seeker(27)
3:31.034 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft, thrill_seeker(28)
3:32.862 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(29)
3:34.169 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft, thrill_seeker(30)
3:35.476 aoe F immolate enemy3 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft, thrill_seeker(30)
3:36.783 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft, thrill_seeker(31)
3:38.002 aoe K impending_catastrophe Fluffy_Pillow 48862.0/50000: 98% mana
2.4/5: 48% soul_shard
thrill_seeker(32)
3:39.742 aoe F immolate enemy2 47732.0/50000: 95% mana
2.9/5: 58% soul_shard
thrill_seeker(32)
3:41.049 aoe E channel_demonfire Fluffy_Pillow 47635.5/50000: 95% mana
2.9/5: 58% soul_shard
thrill_seeker(33)
3:43.879 aoe I rain_of_fire Fluffy_Pillow 48300.5/50000: 97% mana
3.4/5: 68% soul_shard
thrill_seeker(34)
3:45.187 default A cataclysm Fluffy_Pillow 48954.5/50000: 98% mana
0.6/5: 12% soul_shard
thrill_seeker(35)
3:46.927 aoe J conflagrate Fluffy_Pillow 49324.5/50000: 99% mana
1.0/5: 20% soul_shard
thrill_seeker(36)
3:48.233 aoe L incinerate Fluffy_Pillow 49477.5/50000: 99% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(37)
3:49.453 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.9/5: 38% soul_shard
thrill_seeker(37)
3:50.759 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(38)
3:51.978 aoe H havoc enemy2 48765.0/50000: 98% mana
3.0/5: 60% soul_shard
thrill_seeker(38)
3:53.287 havoc Q chaos_bolt Fluffy_Pillow 48419.5/50000: 97% mana
3.2/5: 64% soul_shard
thrill_seeker(39)
3:55.897 havoc N conflagrate Fluffy_Pillow 49724.5/50000: 99% mana
1.6/5: 32% soul_shard
euphoria
3:57.011 havoc P immolate Fluffy_Pillow 49781.5/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker, euphoria
3:58.099 havoc Q chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, thrill_seeker(3), euphoria
3:59.621 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
thrill_seeker(3), euphoria
4:01.072 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
thrill_seeker(4), euphoria
4:02.524 havoc R incinerate Fluffy_Pillow 48728.0/50000: 97% mana
2.3/5: 46% soul_shard
thrill_seeker(5), euphoria
4:03.974 havoc N conflagrate Fluffy_Pillow 48453.0/50000: 97% mana
3.2/5: 64% soul_shard
thrill_seeker(5), euphoria
4:05.064 aoe E channel_demonfire Fluffy_Pillow 48498.0/50000: 97% mana
4.2/5: 84% soul_shard
backdraft, thrill_seeker(6)
4:07.833 aoe F immolate enemy3 49132.5/50000: 98% mana
4.5/5: 90% soul_shard
backdraft, thrill_seeker(7)
4:09.139 aoe F immolate Fluffy_Pillow 49035.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft, thrill_seeker(8)
4:10.447 aoe I rain_of_fire Fluffy_Pillow 48939.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft, thrill_seeker(9)
4:11.754 default 9 soul_fire Fluffy_Pillow 49593.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(9)
4:15.234 aoe F immolate enemy2 49003.5/50000: 98% mana
3.4/5: 68% soul_shard
thrill_seeker(11)
4:16.541 aoe I rain_of_fire Fluffy_Pillow 48907.0/50000: 98% mana
3.7/5: 74% soul_shard
thrill_seeker(12)
4:17.851 default A cataclysm Fluffy_Pillow 49562.0/50000: 99% mana
0.8/5: 16% soul_shard
thrill_seeker(12)
4:19.593 aoe J conflagrate Fluffy_Pillow 49503.0/50000: 99% mana
1.1/5: 22% soul_shard
thrill_seeker(13)
4:20.899 aoe L incinerate Fluffy_Pillow 49656.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(14)
4:22.118 aoe H havoc enemy2 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
thrill_seeker(15)
4:23.425 havoc N conflagrate Fluffy_Pillow 48655.5/50000: 97% mana
2.1/5: 42% soul_shard
thrill_seeker(15)
4:24.732 havoc Q chaos_bolt Fluffy_Pillow 48809.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft, thrill_seeker(16)
4:26.558 havoc R incinerate Fluffy_Pillow 49722.0/50000: 99% mana
1.6/5: 32% soul_shard
thrill_seeker(17)
4:28.298 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
thrill_seeker(18)
4:30.907 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
thrill_seeker(19)
4:32.214 havoc N conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.1/5: 22% soul_shard
thrill_seeker(20)
4:33.523 aoe E channel_demonfire Fluffy_Pillow 49407.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(20)
4:36.462 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(22)
4:37.681 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.0/5: 60% soul_shard
thrill_seeker(22)
4:38.988 aoe F immolate enemy3 49655.5/50000: 99% mana
0.0/5: 0% soul_shard
thrill_seeker(23)
4:40.295 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.3/5: 6% soul_shard
thrill_seeker(24)
4:41.601 aoe K impending_catastrophe Fluffy_Pillow 49405.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, thrill_seeker(24)
4:43.341 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
1.1/5: 22% soul_shard
backdraft, thrill_seeker(25)
4:44.561 aoe L incinerate Fluffy_Pillow 47612.0/50000: 95% mana
1.3/5: 26% soul_shard
thrill_seeker(26)
4:46.303 aoe J conflagrate Fluffy_Pillow 47483.0/50000: 95% mana
1.9/5: 38% soul_shard
thrill_seeker(27)
4:47.610 aoe L incinerate Fluffy_Pillow 47636.5/50000: 95% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(27)
4:48.830 aoe L incinerate Fluffy_Pillow 47246.5/50000: 94% mana
2.9/5: 58% soul_shard
thrill_seeker(28)
4:50.569 default A cataclysm Fluffy_Pillow 47116.0/50000: 94% mana
3.4/5: 68% soul_shard
thrill_seeker(29)
4:52.310 aoe H havoc enemy2 47486.5/50000: 95% mana
3.6/5: 72% soul_shard
thrill_seeker(30)
4:53.615 havoc Q chaos_bolt Fluffy_Pillow 47139.0/50000: 94% mana
3.7/5: 74% soul_shard
thrill_seeker(30)
4:56.224 havoc N conflagrate Fluffy_Pillow 48443.5/50000: 97% mana
2.1/5: 42% soul_shard
thrill_seeker(32)
4:57.530 havoc Q chaos_bolt Fluffy_Pillow 48596.5/50000: 97% mana
3.3/5: 66% soul_shard
backdraft, thrill_seeker(32)
4:59.357 havoc P immolate Fluffy_Pillow 49510.0/50000: 99% mana
1.4/5: 28% soul_shard
thrill_seeker(33)
5:00.665 havoc O soul_fire Fluffy_Pillow 49253.0/50000: 99% mana
1.6/5: 32% soul_shard
thrill_seeker(34)
5:04.143 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.0/5: 80% soul_shard
thrill_seeker(36)
5:06.900 aoe I rain_of_fire Fluffy_Pillow 49631.0/50000: 99% mana
4.4/5: 88% soul_shard
thrill_seeker(37)
5:08.206 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
thrill_seeker(38)
5:09.512 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(38)
5:10.731 aoe F immolate enemy3 49002.0/50000: 98% mana
2.8/5: 56% soul_shard
thrill_seeker(39)
5:12.039 aoe J conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
2.9/5: 58% soul_shard
euphoria
5:13.207 aoe I rain_of_fire Fluffy_Pillow 48990.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, euphoria
5:14.297 aoe L incinerate Fluffy_Pillow 49535.0/50000: 99% mana
0.7/5: 14% soul_shard
backdraft, thrill_seeker, euphoria
5:15.314 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
thrill_seeker, euphoria
5:16.767 aoe L incinerate Fluffy_Pillow 48729.0/50000: 97% mana
1.5/5: 30% soul_shard
thrill_seeker(3), euphoria
5:18.220 aoe L incinerate Fluffy_Pillow 48455.5/50000: 97% mana
2.1/5: 42% soul_shard
thrill_seeker(4), euphoria

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Nadjia"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=331586/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Theotar : 9730 dps, 5195 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9729.5 9729.5 17.6 / 0.180% 847.2 / 8.7% 20.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
410.0 406.6 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 9730
Cataclysm 794 8.2% 9.7 32.44sec 24594 14474 Direct 29.1 6869 13741 8194 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.69 29.06 0.00 0.00 1.6992 0.0000 238252.38 238252.38 0.00% 14473.75 14473.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 23.44 14 32 6868.70 6142 8767 6866.94 6548 7390 160990 160990 0.00%
crit 19.35% 5.62 0 11 13741.29 12284 17526 13714.32 0 16265 77263 77263 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.73
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1059) 0.0% (10.9%) 12.3 25.45sec 25842 9585

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.30 0.00 183.64 0.00 2.6960 0.1636 0.00 0.00 0.00% 9585.39 9585.39

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.30
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1059 10.9% 0.0 0.00sec 0 0 Direct 550.9 484 969 577 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 550.93 0.00 0.00 0.0000 0.0000 317889.90 317889.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 445.05 327 567 483.81 263 1179 484.06 455 517 215321 215321 0.00%
crit 19.22% 105.88 70 149 968.76 525 2356 969.09 803 1119 102569 102569 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1392 (1873) 14.3% (19.2%) 22.6 13.00sec 24805 12605 Direct 45.0 (89.6) 0 9268 9268 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.62 45.00 0.00 0.00 1.9679 0.0000 417071.21 417071.21 0.00% 12605.47 12605.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.00 32 58 9268.13 5862 14778 9267.15 8868 9822 417071 417071 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.72
  • if_expr:cast_time<havoc_remains
    Internal Combustion 481 4.9% 44.6 12.99sec 3225 0 Direct 44.6 2702 5398 3224 19.4%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.62 44.62 0.00 0.00 0.0000 0.0000 143910.13 143910.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 35.96 23 49 2701.86 1 4483 2703.84 2458 2991 97185 97185 0.00%
crit 19.41% 8.66 1 21 5397.85 80 8966 5398.23 2668 7141 46725 46725 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 826 8.5% 37.1 7.97sec 6683 5347 Direct 55.8 3716 7485 4442 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.10 55.83 0.00 0.00 1.2499 0.0000 247972.65 247972.65 0.00% 5347.35 5347.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 45.07 31 60 3715.98 2047 6087 3716.82 3468 4029 167482 167482 0.00%
crit 19.27% 10.76 3 25 7485.33 4095 12173 7482.00 5160 9662 80490 80490 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.42
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.67
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1654 17.0% 28.1 10.41sec 17654 13969 Direct 35.1 1580 3165 1877 18.7%
Periodic 346.8 1041 2082 1242 19.3% 95.5%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.13 35.14 346.77 346.77 1.2638 2.4823 496613.78 496613.78 0.00% 554.06 13969.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.31% 28.57 14 41 1580.36 819 2435 1580.45 1470 1720 45157 45157 0.00%
crit 18.69% 6.57 0 16 3164.69 1639 4862 3158.94 0 3825 20791 20791 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.69% 279.82 217 351 1040.85 1 1522 1040.87 1013 1071 291260 291260 0.00%
crit 19.31% 66.95 40 95 2082.06 8 3044 2082.09 1963 2234 139406 139406 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.96
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.28
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (227) 0.0% (2.3%) 4.7 64.93sec 14504 8764

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.68 0.00 0.00 0.00 1.6551 0.0000 0.00 0.00 0.00% 8764.43 8764.43

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.72
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 14.0 558 1116 668 19.6%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.95 0.00 0.00 0.0000 0.0000 9312.00 9312.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 11.22 6 18 558.02 558 558 558.02 558 558 6259 6259 0.00%
crit 19.61% 2.74 0 9 1116.04 1116 1116 1058.81 0 1116 3053 3053 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 196 2.0% 0.0 0.00sec 0 0 Periodic 101.7 484 967 577 19.2% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 101.70 101.70 0.0000 1.6134 58629.90 58629.90 0.00% 357.33 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.78% 82.15 56 105 483.62 446 488 483.64 482 486 39732 39732 0.00%
crit 19.22% 19.54 8 36 967.01 891 977 966.99 948 977 18898 18898 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 593 6.1% 41.8 6.50sec 4271 2921 Direct 52.7 (52.7) 2848 5654 3389 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.84 52.71 0.00 0.00 1.4622 0.0000 178708.22 178708.22 0.00% 2920.69 2920.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 42.52 25 61 2847.58 1371 4137 2850.77 2594 3150 121074 121074 0.00%
crit 19.33% 10.19 2 20 5653.75 2782 8272 5660.87 4347 6886 57635 57635 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:30.86
    havoc
    [R]:11.25
  • if_expr:cast_time<havoc_remains
Rain of Fire 881 9.1% 16.4 17.53sec 16097 12892 Periodic 389.6 569 1139 679 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.44 0.00 0.00 389.57 1.2486 0.0000 264566.18 264566.18 0.00% 12891.83 12891.83
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.68% 314.32 197 458 569.10 507 723 569.08 546 594 178880 178880 0.00%
crit 19.32% 75.25 45 117 1138.72 1013 1447 1138.71 1096 1210 85686 85686 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.16
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.28
Soul Fire 518 5.3% 5.6 49.45sec 27836 8005 Direct 7.6 17123 34444 20517 19.7%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.59 7.57 0.00 0.00 3.4775 0.0000 155596.46 155596.46 0.00% 8004.76 8004.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.30% 6.08 2 10 17122.74 8613 25570 17166.97 13536 22515 104202 104202 0.00%
crit 19.70% 1.49 0 7 34444.27 17386 50949 27728.23 0 50509 51394 51394 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.63
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.04
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.8% 2.0 180.63sec 12134 10497 Direct 6.0 3348 6696 4041 20.8%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24268.61 24268.61 0.00% 10496.80 10496.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.19% 4.75 1 6 3348.13 3348 3348 3348.13 3348 3348 15909 15909 0.00%
crit 20.81% 1.25 0 5 6696.27 6696 6696 5075.86 0 6696 8360 8360 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3505 / 709
Immolation 3238 6.7% 39.0 5.49sec 4982 0 Direct 117.0 1395 2790 1661 19.0%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194290.65 194290.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.97% 94.73 77 111 1395.06 1395 1395 1395.06 1395 1395 132153 132153 0.00%
crit 19.03% 22.27 6 40 2790.11 2790 2790 2790.11 2790 2790 62138 62138 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 267 0.5% 41.0 5.25sec 390 272 Direct 41.0 326 651 390 19.9%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16003.71 22859.70 29.99% 271.69 271.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.10% 32.84 25 41 325.55 326 326 325.55 326 326 10692 15272 29.99%
crit 19.90% 8.16 0 16 651.10 651 651 650.06 0 651 5312 7588 29.94%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.3% 93.4 3.22sec 1653 1135 Direct 92.7 1395 2790 1666 19.4%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.42 92.71 0.00 0.00 1.4561 0.0000 154422.00 154422.00 0.00% 1135.21 1135.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 74.73 54 97 1395.06 1395 1395 1395.06 1395 1395 104258 104258 0.00%
crit 19.39% 17.98 3 31 2790.11 2790 2790 2790.11 2790 2790 50164 50164 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.87
Simple Action Stats Execute Interval
Venthyr_Theotar
Havoc 9.6 32.24sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.64 0.00 0.00 0.00 1.2443 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.64
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.1 0.0 8.0sec 8.0sec 4.4sec 53.94% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.4s
  • trigger_min/max:1.9s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:53.94%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soothing Shade 4.2 0.0 61.6sec 61.6sec 11.8sec 16.57% 0.00% 0.0 (0.0) 4.1

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 222.8s
  • trigger_min/max:20.0s / 222.8s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.57%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.7s
  • trigger_min/max:180.0s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.7s
  • trigger_min/max:180.0s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.56% 8.31% 14.45% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
soul_fire Soul Shard 6.60 7.25 7.73% 1.10 0.38 5.04%
immolate Soul Shard 346.73 33.43 35.67% 0.10 1.24 3.59%
incinerate Soul Shard 41.85 10.60 11.31% 0.25 0.00 0.04%
conflagrate Soul Shard 37.09 27.90 29.77% 0.75 0.00 0.00%
mana_regen Mana 657.58 122166.31 100.00% 185.78 27731.77 18.50%
immolate_crits Soul Shard 33.80 3.26 3.48% 0.10 0.12 3.45%
incinerate_crits Soul Shard 10.18 1.02 1.09% 0.10 0.00 0.03%
infernal Soul Shard 120.00 10.26 10.94% 0.09 1.74 14.53%
pet - imp
energy_regen Energy 361.58 3565.87 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.59 409.96 27753.9 48988.4 46419.5 50000.0
Soul Shard 4.0 0.31 0.31 3.5 2.2 0.1 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
cataclysm Mana 9.7 4847.7 500.0 500.4 49.1
channel_demonfire Mana 12.3 9222.7 750.0 749.7 34.5
chaos_bolt Soul Shard 22.6 45.2 2.0 2.0 12413.7
conflagrate Mana 37.1 18546.1 500.0 499.9 13.4
havoc Mana 9.6 9642.2 1000.0 1000.3 0.0
immolate Mana 28.1 21090.2 750.0 749.7 23.5
impending_catastrophe Mana 4.7 9381.2 2000.0 2002.7 7.2
incinerate Mana 41.9 41853.1 1000.0 1000.2 4.3
rain_of_fire Soul Shard 16.4 49.3 3.0 3.0 5364.6
soul_fire Mana 6.6 6596.9 1000.0 1180.2 23.6
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 93.4 3736.5 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Venthyr_Theotar Damage Per Second
Count 624
Mean 9729.53
Minimum 9163.03
Maximum 10483.49
Spread ( max - min ) 1320.46
Range [ ( max - min ) / 2 * 100% ] 6.79%
Standard Deviation 223.7759
5th Percentile 9412.94
95th Percentile 10134.99
( 95th Percentile - 5th Percentile ) 722.05
Mean Distribution
Standard Deviation 8.9582
95.00% Confidence Interval ( 9711.97 - 9747.09 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2033
0.1 Scale Factor Error with Delta=300 428
0.05 Scale Factor Error with Delta=300 1710
0.01 Scale Factor Error with Delta=300 42748
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 624
Mean 5194.57
Minimum 4883.62
Maximum 5642.17
Spread ( max - min ) 758.55
Range [ ( max - min ) / 2 * 100% ] 7.30%
Standard Deviation 128.8401
5th Percentile 5012.17
95th Percentile 5417.43
( 95th Percentile - 5th Percentile ) 405.27
Mean Distribution
Standard Deviation 5.1577
95.00% Confidence Interval ( 5184.46 - 5204.68 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2364
0.1 Scale Factor Error with Delta=300 142
0.05 Scale Factor Error with Delta=300 567
0.01 Scale Factor Error with Delta=300 14171
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 624
Mean 9729.53
Minimum 9163.03
Maximum 10483.49
Spread ( max - min ) 1320.46
Range [ ( max - min ) / 2 * 100% ] 6.79%
Damage
Venthyr_Theotar Damage
Count 624
Mean 2552791.40
Minimum 2000941.31
Maximum 3070871.45
Spread ( max - min ) 1069930.14
Range [ ( max - min ) / 2 * 100% ] 20.96%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.63 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.73 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.16 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.30 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.96 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.64 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.28 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.42 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.72 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 30.86 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.67 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.04 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.28 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.72 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.25 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDKLJLDJLALJEHQQRPNQ9FJLEFIJLALJHQRQPRNEIFKLJLLJIA9HRNQRQRNEFFFILJLLAJIHRRNQRRPE9FFIJKLIAHRNQRNPRNEILFJIMLLJDLAHOQNQEDJFFDFLJKLLJAHQQRNPQEJLL9FFFIJLAHNQQRNPEILJLFLKLIJLLAE9HNQNQQPLFJELL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.010 cds M summon_infernal Fluffy_Pillow 49755.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.015 aoe H havoc enemy2 49257.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.022 havoc Q chaos_bolt Fluffy_Pillow 48761.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:08.032 havoc N conflagrate Fluffy_Pillow 49766.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:09.037 havoc Q chaos_bolt Fluffy_Pillow 49768.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.443 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.448 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.454 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.862 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:14.870 havoc Q chaos_bolt Fluffy_Pillow 49960.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.277 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:17.285 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:18.291 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:20.783 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:21.790 aoe F immolate enemy2 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:22.795 aoe F immolate enemy3 49005.0/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:23.802 aoe D rain_of_fire Fluffy_Pillow 48758.5/50000: 98% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:24.810 aoe K impending_catastrophe Fluffy_Pillow 49262.5/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:26.150 aoe L incinerate Fluffy_Pillow 47932.5/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust, backdraft
0:27.089 aoe J conflagrate Fluffy_Pillow 47402.0/50000: 95% mana
1.6/5: 32% soul_shard
bloodlust
0:28.096 aoe L incinerate Fluffy_Pillow 47405.5/50000: 95% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:29.033 aoe D rain_of_fire Fluffy_Pillow 46874.0/50000: 94% mana
3.1/5: 62% soul_shard
bloodlust
0:30.041 aoe J conflagrate Fluffy_Pillow 47378.0/50000: 95% mana
0.5/5: 10% soul_shard
bloodlust
0:31.049 aoe L incinerate Fluffy_Pillow 47382.0/50000: 95% mana
1.3/5: 26% soul_shard
bloodlust, backdraft
0:31.988 default A cataclysm Fluffy_Pillow 46851.5/50000: 94% mana
1.8/5: 36% soul_shard
bloodlust
0:33.327 aoe L incinerate Fluffy_Pillow 47021.0/50000: 94% mana
2.2/5: 44% soul_shard
bloodlust
0:34.668 aoe J conflagrate Fluffy_Pillow 46691.5/50000: 93% mana
2.8/5: 56% soul_shard
bloodlust
0:35.675 aoe E channel_demonfire Fluffy_Pillow 46695.0/50000: 93% mana
3.4/5: 68% soul_shard
bloodlust, backdraft
0:37.997 aoe H havoc enemy2 47106.0/50000: 94% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:39.002 havoc Q chaos_bolt Fluffy_Pillow 46608.5/50000: 93% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:40.408 havoc Q chaos_bolt Fluffy_Pillow 47311.5/50000: 95% mana
2.2/5: 44% soul_shard
bloodlust
0:42.418 havoc R incinerate Fluffy_Pillow 48316.5/50000: 97% mana
0.5/5: 10% soul_shard
0:44.158 havoc P immolate Fluffy_Pillow 48186.5/50000: 96% mana
1.0/5: 20% soul_shard
0:45.465 havoc N conflagrate Fluffy_Pillow 48090.0/50000: 96% mana
1.3/5: 26% soul_shard
soothing_shade
0:46.770 havoc Q chaos_bolt Fluffy_Pillow 48242.5/50000: 96% mana
2.3/5: 46% soul_shard
backdraft, soothing_shade
0:48.598 default 9 soul_fire Fluffy_Pillow 49156.5/50000: 98% mana
0.7/5: 14% soul_shard
soothing_shade
0:52.077 aoe F immolate enemy3 49003.0/50000: 98% mana
2.0/5: 40% soul_shard
soothing_shade
0:53.384 aoe J conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
2.3/5: 46% soul_shard
soothing_shade
0:54.691 aoe L incinerate Fluffy_Pillow 49060.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, soothing_shade
0:55.910 aoe E channel_demonfire Fluffy_Pillow 48669.5/50000: 97% mana
3.3/5: 66% soul_shard
soothing_shade
0:58.797 aoe F immolate enemy2 49363.0/50000: 99% mana
3.7/5: 74% soul_shard
1:00.103 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
4.0/5: 80% soul_shard
1:01.410 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
1.0/5: 20% soul_shard
1:02.717 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft
1:03.937 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
1:05.677 aoe L incinerate Fluffy_Pillow 49372.5/50000: 99% mana
2.3/5: 46% soul_shard
1:07.418 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
1:08.726 aoe H havoc enemy2 49156.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:10.032 havoc Q chaos_bolt Fluffy_Pillow 48809.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:11.861 havoc R incinerate Fluffy_Pillow 49724.0/50000: 99% mana
1.7/5: 34% soul_shard
1:13.602 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
1:16.211 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:17.518 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
1:19.257 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.5/5: 30% soul_shard
1:20.562 aoe E channel_demonfire Fluffy_Pillow 49154.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:23.456 aoe I rain_of_fire Fluffy_Pillow 49851.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
1:24.763 aoe F immolate enemy3 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
1:26.069 aoe K impending_catastrophe Fluffy_Pillow 49252.0/50000: 99% mana
0.3/5: 6% soul_shard
backdraft
1:27.886 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
0.5/5: 10% soul_shard
backdraft
1:29.105 aoe J conflagrate Fluffy_Pillow 47611.5/50000: 95% mana
1.0/5: 20% soul_shard
1:30.411 aoe L incinerate Fluffy_Pillow 47764.5/50000: 96% mana
1.5/5: 30% soul_shard
backdraft
1:31.629 aoe L incinerate Fluffy_Pillow 47373.5/50000: 95% mana
2.0/5: 40% soul_shard
1:33.369 aoe J conflagrate Fluffy_Pillow 47243.5/50000: 94% mana
2.2/5: 44% soul_shard
1:34.675 aoe I rain_of_fire Fluffy_Pillow 47396.5/50000: 95% mana
3.0/5: 60% soul_shard
backdraft
1:35.982 default A cataclysm Fluffy_Pillow 48050.0/50000: 96% mana
0.2/5: 4% soul_shard
backdraft
1:37.721 default 9 soul_fire Fluffy_Pillow 48419.5/50000: 97% mana
0.3/5: 6% soul_shard
backdraft
1:41.199 aoe H havoc enemy2 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
1:42.506 havoc R incinerate Fluffy_Pillow 48656.0/50000: 97% mana
1.7/5: 34% soul_shard
backdraft
1:43.726 havoc N conflagrate Fluffy_Pillow 48266.0/50000: 97% mana
2.3/5: 46% soul_shard
1:45.032 havoc Q chaos_bolt Fluffy_Pillow 48419.0/50000: 97% mana
3.4/5: 68% soul_shard
backdraft
1:46.858 havoc R incinerate Fluffy_Pillow 49332.0/50000: 99% mana
1.7/5: 34% soul_shard
1:48.598 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
1:51.205 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:52.945 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
1:54.252 aoe E channel_demonfire Fluffy_Pillow 49155.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:57.062 aoe F immolate enemy3 49810.5/50000: 100% mana
3.2/5: 64% soul_shard
backdraft, soothing_shade
1:58.370 aoe F immolate Fluffy_Pillow 49253.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft, soothing_shade
1:59.677 aoe F immolate enemy2 49156.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, soothing_shade
2:00.982 aoe I rain_of_fire Fluffy_Pillow 49059.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, soothing_shade
2:02.287 aoe L incinerate Fluffy_Pillow 49711.5/50000: 99% mana
0.5/5: 10% soul_shard
backdraft, soothing_shade
2:03.507 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
soothing_shade
2:04.815 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.4/5: 28% soul_shard
backdraft, soothing_shade
2:06.035 aoe L incinerate Fluffy_Pillow 48766.5/50000: 98% mana
1.8/5: 36% soul_shard
soothing_shade
2:07.775 default A cataclysm Fluffy_Pillow 48636.5/50000: 97% mana
2.2/5: 44% soul_shard
soothing_shade
2:09.516 aoe J conflagrate Fluffy_Pillow 49007.0/50000: 98% mana
2.4/5: 48% soul_shard
2:10.823 aoe I rain_of_fire Fluffy_Pillow 49160.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:12.129 aoe H havoc enemy2 49813.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
2:13.436 havoc R incinerate Fluffy_Pillow 49467.0/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
2:14.656 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
2:16.395 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.7/5: 34% soul_shard
2:17.832 havoc Q chaos_bolt Fluffy_Pillow 49090.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:19.659 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
2:21.399 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
2:23.139 havoc P immolate Fluffy_Pillow 48872.0/50000: 98% mana
2.4/5: 48% soul_shard
2:24.445 aoe E channel_demonfire Fluffy_Pillow 48775.0/50000: 98% mana
2.6/5: 52% soul_shard
2:27.186 default 9 soul_fire Fluffy_Pillow 49395.5/50000: 99% mana
3.0/5: 60% soul_shard
2:30.662 aoe F immolate enemy2 49001.5/50000: 98% mana
4.4/5: 88% soul_shard
2:31.970 aoe F immolate enemy3 48905.5/50000: 98% mana
4.6/5: 92% soul_shard
2:33.276 aoe I rain_of_fire Fluffy_Pillow 48808.5/50000: 98% mana
4.7/5: 94% soul_shard
2:34.582 aoe J conflagrate Fluffy_Pillow 49461.5/50000: 99% mana
2.0/5: 40% soul_shard
2:35.888 aoe K impending_catastrophe Fluffy_Pillow 49614.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
2:37.628 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
2.8/5: 56% soul_shard
backdraft
2:38.847 aoe I rain_of_fire Fluffy_Pillow 47611.5/50000: 95% mana
3.2/5: 64% soul_shard
2:40.152 default A cataclysm Fluffy_Pillow 48264.0/50000: 97% mana
0.3/5: 6% soul_shard
2:41.890 aoe H havoc enemy2 48633.0/50000: 97% mana
0.5/5: 10% soul_shard
2:43.436 havoc R incinerate Fluffy_Pillow 48406.0/50000: 97% mana
0.6/5: 12% soul_shard
2:45.177 havoc N conflagrate Fluffy_Pillow 48276.5/50000: 97% mana
1.3/5: 26% soul_shard
2:46.482 havoc Q chaos_bolt Fluffy_Pillow 48429.0/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
2:48.308 havoc R incinerate Fluffy_Pillow 49342.0/50000: 99% mana
0.7/5: 14% soul_shard
2:50.047 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
2:51.354 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:52.660 havoc R incinerate Fluffy_Pillow 49058.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:53.879 havoc N conflagrate Fluffy_Pillow 48667.5/50000: 97% mana
3.2/5: 64% soul_shard
2:55.187 aoe E channel_demonfire Fluffy_Pillow 48821.5/50000: 98% mana
4.4/5: 88% soul_shard
backdraft
2:57.973 aoe I rain_of_fire Fluffy_Pillow 49464.5/50000: 99% mana
4.9/5: 98% soul_shard
backdraft
2:59.280 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft, soothing_shade
3:00.499 aoe F immolate enemy3 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
soothing_shade
3:01.805 aoe J conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
2.5/5: 50% soul_shard
soothing_shade
3:03.112 aoe I rain_of_fire Fluffy_Pillow 49058.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, soothing_shade
3:04.419 cds M summon_infernal Fluffy_Pillow 49712.0/50000: 99% mana
0.3/5: 6% soul_shard
backdraft, soothing_shade
3:05.725 aoe L incinerate Fluffy_Pillow 49365.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, soothing_shade
3:06.944 aoe L incinerate Fluffy_Pillow 48974.5/50000: 98% mana
1.4/5: 28% soul_shard
soothing_shade
3:08.687 aoe J conflagrate Fluffy_Pillow 48846.0/50000: 98% mana
2.2/5: 44% soul_shard
soothing_shade
3:09.992 aoe D rain_of_fire Fluffy_Pillow 48998.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, soothing_shade
3:11.296 aoe L incinerate Fluffy_Pillow 49650.5/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
3:12.516 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
3:14.257 aoe H havoc enemy2 49373.0/50000: 99% mana
1.6/5: 32% soul_shard
3:15.563 havoc O soul_fire Fluffy_Pillow 49026.0/50000: 98% mana
2.1/5: 42% soul_shard
3:19.135 havoc Q chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
3:21.744 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:23.049 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:24.878 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:27.716 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.8/5: 76% soul_shard
3:29.022 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
3:30.328 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
3:31.635 aoe F immolate enemy2 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
3:32.941 aoe D rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
3:34.247 aoe F immolate enemy3 49808.5/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
3:35.553 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
3:36.772 aoe J conflagrate Fluffy_Pillow 48861.5/50000: 98% mana
1.3/5: 26% soul_shard
3:38.079 aoe K impending_catastrophe Fluffy_Pillow 49015.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:39.819 aoe L incinerate Fluffy_Pillow 47885.0/50000: 96% mana
2.2/5: 44% soul_shard
backdraft
3:41.038 aoe L incinerate Fluffy_Pillow 47494.5/50000: 95% mana
2.5/5: 50% soul_shard
3:42.778 aoe J conflagrate Fluffy_Pillow 47364.5/50000: 95% mana
3.0/5: 60% soul_shard
3:44.323 default A cataclysm Fluffy_Pillow 47637.0/50000: 95% mana
3.7/5: 74% soul_shard
backdraft
3:46.062 aoe H havoc enemy2 48006.5/50000: 96% mana
3.9/5: 78% soul_shard
backdraft
3:47.369 havoc Q chaos_bolt Fluffy_Pillow 47660.0/50000: 95% mana
4.1/5: 82% soul_shard
backdraft
3:49.195 havoc Q chaos_bolt Fluffy_Pillow 48573.0/50000: 97% mana
2.4/5: 48% soul_shard
3:51.805 havoc R incinerate Fluffy_Pillow 49878.0/50000: 100% mana
0.7/5: 14% soul_shard
3:53.546 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
3:54.854 havoc P immolate Fluffy_Pillow 49156.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:56.162 havoc Q chaos_bolt Fluffy_Pillow 49060.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
3:57.989 aoe E channel_demonfire Fluffy_Pillow 49974.0/50000: 100% mana
0.9/5: 18% soul_shard
4:00.898 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
4:02.204 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft
4:03.423 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
4:05.163 default 9 soul_fire Fluffy_Pillow 48872.0/50000: 98% mana
2.8/5: 56% soul_shard
4:08.640 aoe F immolate enemy3 49002.0/50000: 98% mana
4.3/5: 86% soul_shard
4:09.945 aoe F immolate Fluffy_Pillow 48904.5/50000: 98% mana
4.5/5: 90% soul_shard
4:11.250 aoe F immolate enemy2 48807.0/50000: 98% mana
4.6/5: 92% soul_shard
4:12.557 aoe I rain_of_fire Fluffy_Pillow 48710.5/50000: 97% mana
4.9/5: 98% soul_shard
4:13.862 aoe J conflagrate Fluffy_Pillow 49363.0/50000: 99% mana
1.9/5: 38% soul_shard
4:15.167 aoe L incinerate Fluffy_Pillow 49515.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
4:16.386 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.9/5: 58% soul_shard
4:18.126 aoe H havoc enemy2 49372.0/50000: 99% mana
3.2/5: 64% soul_shard
4:19.433 havoc N conflagrate Fluffy_Pillow 49025.5/50000: 98% mana
3.2/5: 64% soul_shard
4:20.738 havoc Q chaos_bolt Fluffy_Pillow 49178.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft, soothing_shade
4:22.566 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
soothing_shade
4:25.177 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
soothing_shade
4:26.917 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
soothing_shade
4:28.223 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, soothing_shade
4:29.530 aoe E channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, soothing_shade
4:32.425 aoe I rain_of_fire Fluffy_Pillow 49756.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
4:33.731 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
4:34.950 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
4:36.259 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
4:37.478 aoe F immolate enemy3 48766.0/50000: 98% mana
1.9/5: 38% soul_shard
4:38.784 aoe L incinerate Fluffy_Pillow 48669.0/50000: 97% mana
2.2/5: 44% soul_shard
4:40.523 aoe K impending_catastrophe Fluffy_Pillow 48538.5/50000: 97% mana
2.4/5: 48% soul_shard
4:42.264 aoe L incinerate Fluffy_Pillow 47409.0/50000: 95% mana
2.8/5: 56% soul_shard
4:44.006 aoe I rain_of_fire Fluffy_Pillow 47280.0/50000: 95% mana
3.3/5: 66% soul_shard
4:45.312 aoe J conflagrate Fluffy_Pillow 47933.0/50000: 96% mana
0.3/5: 6% soul_shard
4:46.618 aoe L incinerate Fluffy_Pillow 48086.0/50000: 96% mana
1.1/5: 22% soul_shard
backdraft
4:47.836 aoe L incinerate Fluffy_Pillow 47695.0/50000: 95% mana
1.3/5: 26% soul_shard
4:49.577 default A cataclysm Fluffy_Pillow 47565.5/50000: 95% mana
2.0/5: 40% soul_shard
4:51.317 aoe E channel_demonfire Fluffy_Pillow 47935.5/50000: 96% mana
2.1/5: 42% soul_shard
4:54.164 default 9 soul_fire Fluffy_Pillow 48609.0/50000: 97% mana
2.4/5: 48% soul_shard
4:57.641 aoe H havoc enemy2 49002.0/50000: 98% mana
3.8/5: 76% soul_shard
4:58.950 havoc N conflagrate Fluffy_Pillow 48656.5/50000: 97% mana
3.8/5: 76% soul_shard
5:00.257 havoc Q chaos_bolt Fluffy_Pillow 48810.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
5:02.084 havoc N conflagrate Fluffy_Pillow 49723.5/50000: 99% mana
3.0/5: 60% soul_shard
5:03.393 havoc Q chaos_bolt Fluffy_Pillow 49878.0/50000: 100% mana
4.0/5: 80% soul_shard
backdraft
5:05.221 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
5:07.832 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
soothing_shade
5:09.138 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
soothing_shade
5:10.880 aoe F immolate enemy3 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
soothing_shade
5:12.187 aoe J conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
1.4/5: 28% soul_shard
soothing_shade
5:13.494 aoe E channel_demonfire Fluffy_Pillow 49060.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, soothing_shade
5:16.420 aoe L incinerate Fluffy_Pillow 49773.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft, soothing_shade
5:17.641 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.8/5: 56% soul_shard
soothing_shade

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Theotar"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=336239/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

destruction : 9231 dps, 4973 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9231.3 9231.3 16.2 / 0.175% 790.3 / 8.6% 20.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
395.2 392.7 Mana 0.00% 38.2 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
destruction 9231
Cataclysm 771 8.4% 9.7 32.45sec 23921 14078 Direct 29.0 6699 13401 7972 19.0%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.67 29.01 0.00 0.00 1.6991 0.0000 231308.46 231308.46 0.00% 14078.42 14078.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.99% 23.49 14 35 6698.81 6141 7261 6699.57 6462 6902 157384 157384 0.00%
crit 19.01% 5.52 0 15 13400.74 12284 14521 13353.05 0 14393 73925 73925 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.73
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1033) 0.0% (11.2%) 12.3 25.32sec 25123 9317

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.33 0.00 184.13 0.00 2.6965 0.1637 0.00 0.00 0.00% 9317.08 9317.08

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.33
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1033 11.2% 0.0 0.00sec 0 0 Direct 552.4 470 941 561 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 552.39 0.00 0.00 0.0000 0.0000 309811.56 309811.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 446.23 310 573 470.45 263 976 470.66 448 495 209887 209887 0.00%
crit 19.22% 106.17 65 153 940.67 525 1952 941.51 809 1070 99924 99924 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1252 (1705) 13.6% (18.5%) 22.2 13.30sec 23085 11734 Direct 44.1 (87.6) 0 8523 8523 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.17 44.08 0.00 0.00 1.9674 0.0000 375673.48 375673.48 0.00% 11734.00 11734.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.08 30 58 8522.71 5861 11548 8522.52 8348 8714 375673 375673 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [P]:22.28
  • if_expr:cast_time<havoc_remains
    Internal Combustion 454 4.9% 43.5 13.29sec 3124 0 Direct 43.5 2634 5238 3126 18.9%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.55 43.54 0.00 0.00 0.0000 0.0000 136046.24 136046.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.15% 35.33 23 52 2633.53 1 3715 2633.98 2430 2846 93028 93028 0.00%
crit 18.85% 8.21 2 19 5238.36 2 7428 5239.93 3703 6359 43018 43018 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 802 8.7% 37.1 7.94sec 6487 5191 Direct 56.1 3596 7229 4288 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.09 56.11 0.00 0.00 1.2499 0.0000 240628.49 240628.49 0.00% 5190.55 5190.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.94% 45.41 32 60 3596.47 2047 5042 3596.59 3363 3805 163312 163312 0.00%
crit 19.06% 10.70 2 26 7228.60 4095 10084 7211.45 4979 8650 77317 77317 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.13
  • if_expr:buff.backdraft.down
    havoc
    [M]:18.95
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1611 17.5% 28.0 10.40sec 17266 13664 Direct 35.1 1535 3067 1830 19.2%
Periodic 347.3 1014 2026 1208 19.2% 95.6%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.02 35.08 347.30 347.30 1.2637 2.4820 483793.21 483793.21 0.00% 539.11 13663.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 28.34 18 42 1534.77 819 2017 1535.20 1420 1656 43490 43490 0.00%
crit 19.20% 6.74 0 14 3066.59 1638 4033 3058.83 0 3822 20657 20657 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.80% 280.60 214 347 1013.99 1 1261 1014.05 997 1039 284516 284516 0.00%
crit 19.20% 66.69 40 100 2025.91 4 2521 2026.28 1922 2124 135130 135130 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.61
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:8.52
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 608 6.6% 46.9 5.85sec 3897 2634 Direct 58.3 (58.3) 2632 5267 3137 19.1% (19.1%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.89 58.27 0.00 0.00 1.4794 0.0000 182716.57 182716.57 0.00% 2633.94 2633.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 47.13 28 67 2631.87 1312 3232 2631.73 2464 2785 124024 124024 0.00%
crit 19.12% 11.14 1 21 5267.05 2625 6464 5269.21 2857 6154 58693 58693 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [K]:35.38
    havoc
    [Q]:11.77
  • if_expr:cast_time<havoc_remains
Rain of Fire 889 9.6% 17.1 16.87sec 15613 12550 Periodic 404.3 553 1105 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.06 0.00 0.00 404.29 1.2441 0.0000 266341.55 266341.55 0.00% 12549.67 12549.67
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.80% 326.68 227 444 552.68 507 599 552.66 546 559 180546 180546 0.00%
crit 19.20% 77.61 37 119 1105.43 1013 1198 1105.46 1085 1131 85796 85796 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.14
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.92
Soul Fire 508 5.5% 5.6 49.60sec 27304 7852 Direct 7.6 16958 34005 20111 18.7%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.58 7.57 0.00 0.00 3.4775 0.0000 152403.00 152403.00 0.00% 7851.78 7851.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.32% 6.15 1 10 16958.32 8601 21175 16980.99 14220 20009 104354 104354 0.00%
crit 18.68% 1.41 0 7 34005.02 17216 42339 27045.43 0 42339 48049 48049 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.61
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [N]:1.05
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.9% 2.0 180.52sec 11979 10362 Direct 6.0 3348 6696 3995 19.3%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23957.41 23957.41 0.00% 10362.20 10362.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 4.84 2 6 3348.13 3348 3348 3348.13 3348 3348 16220 16220 0.00%
crit 19.26% 1.16 0 4 6696.27 6696 6696 4861.23 0 6696 7737 7737 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [L]:2.00
pet - infernal 3507 / 710
Immolation 3242 7.0% 39.0 5.49sec 4988 0 Direct 117.0 1395 2790 1662 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194514.21 194514.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 94.57 79 108 1395.06 1395 1395 1395.06 1395 1395 131929 131929 0.00%
crit 19.17% 22.43 9 38 2790.11 2790 2790 2790.11 2790 2790 62585 62585 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15922.32 22743.44 29.99% 270.31 270.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 33.09 24 40 325.55 326 326 325.55 326 326 10773 15388 29.99%
crit 19.29% 7.91 1 17 651.10 651 651 651.10 651 651 5149 7355 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.6% 93.4 3.22sec 1655 1137 Direct 92.7 1395 2790 1668 19.6%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.42 92.71 0.00 0.00 1.4561 0.0000 154650.03 154650.03 0.00% 1136.89 1136.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.43% 74.57 53 97 1395.06 1395 1395 1395.06 1395 1395 104030 104030 0.00%
crit 19.57% 18.14 5 34 2790.11 2790 2790 2790.11 2790 2790 50620 50620 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.87
Simple Action Stats Execute Interval
destruction
Havoc 9.6 32.27sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.62 0.00 0.00 0.00 1.2441 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.62
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.1 0.0 8.0sec 8.0sec 4.1sec 50.97% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 23.5s
  • trigger_min/max:2.0s / 23.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.97%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:destruction_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:destruction_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.94% 9.21% 15.65% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
destruction
soul_fire Soul Shard 6.59 7.21 7.61% 1.09 0.41 5.44%
immolate Soul Shard 347.25 33.34 35.18% 0.10 1.39 4.00%
incinerate Soul Shard 46.91 11.72 12.37% 0.25 0.00 0.03%
conflagrate Soul Shard 37.08 28.04 29.60% 0.76 0.00 0.00%
mana_regen Mana 657.03 117995.71 100.00% 179.59 31917.38 21.29%
immolate_crits Soul Shard 33.13 3.18 3.36% 0.10 0.13 3.87%
incinerate_crits Soul Shard 11.17 1.12 1.18% 0.10 0.00 0.00%
infernal Soul Shard 120.00 10.14 10.70% 0.08 1.86 15.53%
pet - imp
energy_regen Energy 361.58 3565.87 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 392.70 395.22 31939.8 49245.7 47875.5 50000.0
Soul Shard 4.0 0.32 0.32 3.8 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
destruction
cataclysm Mana 9.7 4839.1 500.0 500.4 47.8
channel_demonfire Mana 12.3 9249.6 750.0 750.1 33.5
chaos_bolt Soul Shard 22.1 44.3 2.0 2.0 11556.1
conflagrate Mana 37.1 18539.8 500.0 499.8 13.0
havoc Mana 9.6 9614.1 1000.0 999.9 0.0
immolate Mana 28.0 21010.5 750.0 749.9 23.0
incinerate Mana 46.9 46914.1 1000.0 1000.5 3.9
rain_of_fire Soul Shard 17.1 51.2 3.0 3.0 5203.7
soul_fire Mana 6.6 6589.1 1000.0 1180.5 23.1
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.4 3736.5 40.0 40.0 41.4

Statistics & Data Analysis

Fight Length
destruction Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
destruction Damage Per Second
Count 624
Mean 9231.29
Minimum 8742.98
Maximum 9856.27
Spread ( max - min ) 1113.29
Range [ ( max - min ) / 2 * 100% ] 6.03%
Standard Deviation 205.8560
5th Percentile 8933.44
95th Percentile 9575.70
( 95th Percentile - 5th Percentile ) 642.25
Mean Distribution
Standard Deviation 8.2408
95.00% Confidence Interval ( 9215.14 - 9247.45 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1911
0.1 Scale Factor Error with Delta=300 362
0.05 Scale Factor Error with Delta=300 1448
0.01 Scale Factor Error with Delta=300 36176
Priority Target DPS
destruction Priority Target Damage Per Second
Count 624
Mean 4972.98
Minimum 4686.98
Maximum 5392.13
Spread ( max - min ) 705.15
Range [ ( max - min ) / 2 * 100% ] 7.09%
Standard Deviation 115.4687
5th Percentile 4798.76
95th Percentile 5160.13
( 95th Percentile - 5th Percentile ) 361.38
Mean Distribution
Standard Deviation 4.6224
95.00% Confidence Interval ( 4963.92 - 4982.04 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2072
0.1 Scale Factor Error with Delta=300 114
0.05 Scale Factor Error with Delta=300 456
0.01 Scale Factor Error with Delta=300 11382
DPS(e)
destruction Damage Per Second (Effective)
Count 624
Mean 9231.29
Minimum 8742.98
Maximum 9856.27
Spread ( max - min ) 1113.29
Range [ ( max - min ) / 2 * 100% ] 6.03%
Damage
destruction Damage
Count 624
Mean 2402679.97
Minimum 1939749.26
Maximum 2917036.02
Spread ( max - min ) 977286.76
Range [ ( max - min ) / 2 * 100% ] 20.34%
DTPS
destruction Damage Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
destruction Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
destruction Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
destruction Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
destruction Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
destruction Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
destructionTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
destruction Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.61 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.73 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.14 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.33 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.61 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.62 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.92 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.13 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 35.38 incinerate
actions.cds
# count action,conditions
L 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
M 18.95 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
N 1.05 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
O 8.52 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
P 22.28 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
Q 11.77 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AELHPMPMOPMPMDFEFDFKJKKDJKAKIHQMPQMOP9EFIJKKFJKAIHQMPQQMOEFIFKJKKIKJA9EHMPPMOPKFKJKEFIAJKKHPQMOPQM9EFIJKKAIJHQPQMOPEKFJFLDKKJKAD9EHPMPMOPDFJKKKEAIJKKHMPOQPQ9EFFIJKAJKJHPQMOPQEJFIKKKFFJAKI9EHMPMPQOMFIKKKE

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.814 cds L summon_infernal Fluffy_Pillow 49657.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.820 aoe H havoc enemy2 49160.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.827 havoc P chaos_bolt Fluffy_Pillow 48663.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.836 havoc M conflagrate Fluffy_Pillow 49668.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.842 havoc P chaos_bolt Fluffy_Pillow 49671.0/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.248 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.254 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.259 havoc P chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.665 havoc M conflagrate Fluffy_Pillow 49954.5/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:14.672 havoc P chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:16.079 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:17.085 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:18.091 aoe F immolate enemy2 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:19.097 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:21.357 aoe F immolate Fluffy_Pillow 49632.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:22.364 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:23.372 aoe F immolate enemy3 49756.5/50000: 100% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:24.378 aoe K incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
bloodlust, backdraft
0:25.317 aoe J conflagrate Fluffy_Pillow 48721.5/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust
0:26.324 aoe K incinerate Fluffy_Pillow 48725.0/50000: 97% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:27.264 aoe K incinerate Fluffy_Pillow 48195.0/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust
0:28.605 aoe D rain_of_fire Fluffy_Pillow 47865.5/50000: 96% mana
3.5/5: 70% soul_shard
bloodlust
0:29.609 aoe J conflagrate Fluffy_Pillow 48367.5/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust
0:30.616 aoe K incinerate Fluffy_Pillow 48371.0/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:31.554 default A cataclysm Fluffy_Pillow 47840.0/50000: 96% mana
2.1/5: 42% soul_shard
bloodlust
0:33.075 aoe K incinerate Fluffy_Pillow 48100.5/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust
0:34.417 aoe I rain_of_fire Fluffy_Pillow 47771.5/50000: 96% mana
3.4/5: 68% soul_shard
bloodlust
0:35.424 aoe H havoc enemy2 48275.0/50000: 97% mana
0.4/5: 8% soul_shard
bloodlust
0:36.430 havoc Q incinerate Fluffy_Pillow 47778.0/50000: 96% mana
0.7/5: 14% soul_shard
bloodlust
0:37.771 havoc M conflagrate Fluffy_Pillow 47448.5/50000: 95% mana
1.2/5: 24% soul_shard
bloodlust
0:38.776 havoc P chaos_bolt Fluffy_Pillow 47451.0/50000: 95% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:40.182 havoc Q incinerate Fluffy_Pillow 48154.0/50000: 96% mana
0.6/5: 12% soul_shard
bloodlust
0:41.521 havoc M conflagrate Fluffy_Pillow 47823.5/50000: 96% mana
1.2/5: 24% soul_shard
0:42.827 havoc O immolate Fluffy_Pillow 47976.5/50000: 96% mana
2.7/5: 54% soul_shard
backdraft
0:44.134 havoc P chaos_bolt Fluffy_Pillow 47880.0/50000: 96% mana
2.7/5: 54% soul_shard
backdraft
0:45.960 default 9 soul_fire Fluffy_Pillow 48793.0/50000: 98% mana
1.0/5: 20% soul_shard
0:49.438 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
0:52.253 aoe F immolate enemy3 49660.0/50000: 99% mana
2.9/5: 58% soul_shard
0:53.563 aoe I rain_of_fire Fluffy_Pillow 49254.0/50000: 99% mana
3.1/5: 62% soul_shard
0:54.868 aoe J conflagrate Fluffy_Pillow 49906.5/50000: 100% mana
0.3/5: 6% soul_shard
0:56.174 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
backdraft
0:57.394 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
0:59.134 aoe F immolate enemy2 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
1:00.441 aoe J conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
1.9/5: 38% soul_shard
1:01.747 aoe K incinerate Fluffy_Pillow 48929.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:02.966 default A cataclysm Fluffy_Pillow 48538.5/50000: 97% mana
2.9/5: 58% soul_shard
1:04.812 aoe I rain_of_fire Fluffy_Pillow 48961.5/50000: 98% mana
3.1/5: 62% soul_shard
1:06.118 aoe H havoc enemy2 49614.5/50000: 99% mana
0.4/5: 8% soul_shard
1:07.424 havoc Q incinerate Fluffy_Pillow 49267.5/50000: 99% mana
0.4/5: 8% soul_shard
1:09.163 havoc M conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
1:10.468 havoc P chaos_bolt Fluffy_Pillow 49154.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
1:12.295 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:14.036 havoc Q incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
1:15.778 havoc M conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
1.8/5: 36% soul_shard
1:17.085 havoc O immolate Fluffy_Pillow 49027.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
1:18.392 aoe E channel_demonfire Fluffy_Pillow 48930.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:21.310 aoe F immolate enemy2 49639.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
1:22.617 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
1:23.924 aoe F immolate enemy3 49906.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
1:25.231 aoe K incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
1:26.450 aoe J conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
1.4/5: 28% soul_shard
1:27.758 aoe K incinerate Fluffy_Pillow 49016.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
1:28.979 aoe K incinerate Fluffy_Pillow 48626.5/50000: 97% mana
2.5/5: 50% soul_shard
1:30.719 aoe I rain_of_fire Fluffy_Pillow 48496.5/50000: 97% mana
3.0/5: 60% soul_shard
1:32.024 aoe K incinerate Fluffy_Pillow 49149.0/50000: 98% mana
0.3/5: 6% soul_shard
1:33.764 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.5/5: 10% soul_shard
1:35.070 default A cataclysm Fluffy_Pillow 49155.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
1:36.810 default 9 soul_fire Fluffy_Pillow 49502.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
1:40.287 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:43.230 aoe H havoc enemy2 49723.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
1:44.537 havoc M conflagrate Fluffy_Pillow 49377.0/50000: 99% mana
3.4/5: 68% soul_shard
1:45.845 havoc P chaos_bolt Fluffy_Pillow 49531.0/50000: 99% mana
4.6/5: 92% soul_shard
backdraft
1:47.671 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
1:50.283 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
1:51.632 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
1:52.938 havoc P chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
1:54.765 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:56.504 aoe F immolate enemy3 49001.5/50000: 98% mana
1.0/5: 20% soul_shard
1:57.811 aoe K incinerate Fluffy_Pillow 48905.0/50000: 98% mana
1.2/5: 24% soul_shard
1:59.551 aoe J conflagrate Fluffy_Pillow 48775.0/50000: 98% mana
1.6/5: 32% soul_shard
2:00.859 aoe K incinerate Fluffy_Pillow 48929.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:02.078 aoe E channel_demonfire Fluffy_Pillow 48538.5/50000: 97% mana
2.6/5: 52% soul_shard
2:04.954 aoe F immolate enemy2 49226.5/50000: 98% mana
2.9/5: 58% soul_shard
2:06.260 aoe I rain_of_fire Fluffy_Pillow 49129.5/50000: 98% mana
3.2/5: 64% soul_shard
2:07.566 default A cataclysm Fluffy_Pillow 49782.5/50000: 100% mana
0.2/5: 4% soul_shard
2:09.309 aoe J conflagrate Fluffy_Pillow 49503.5/50000: 99% mana
0.8/5: 16% soul_shard
2:10.616 aoe K incinerate Fluffy_Pillow 49657.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
2:11.836 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
2:13.579 aoe H havoc enemy2 48874.0/50000: 98% mana
2.0/5: 40% soul_shard
2:14.887 havoc P chaos_bolt Fluffy_Pillow 48528.0/50000: 97% mana
2.4/5: 48% soul_shard
2:17.494 havoc Q incinerate Fluffy_Pillow 49831.5/50000: 100% mana
0.7/5: 14% soul_shard
2:19.234 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:20.539 havoc O immolate Fluffy_Pillow 49154.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:21.845 havoc P chaos_bolt Fluffy_Pillow 49057.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:23.673 havoc Q incinerate Fluffy_Pillow 49971.5/50000: 100% mana
0.8/5: 16% soul_shard
2:25.413 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
2:26.722 default 9 soul_fire Fluffy_Pillow 49156.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:30.199 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.2/5: 84% soul_shard
backdraft
2:33.035 aoe F immolate enemy3 49670.0/50000: 99% mana
4.6/5: 92% soul_shard
backdraft
2:34.342 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.6/5: 92% soul_shard
backdraft
2:35.649 aoe J conflagrate Fluffy_Pillow 49906.0/50000: 100% mana
1.8/5: 36% soul_shard
2:36.956 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft
2:38.178 aoe K incinerate Fluffy_Pillow 49003.5/50000: 98% mana
2.8/5: 56% soul_shard
2:39.917 default A cataclysm Fluffy_Pillow 48873.0/50000: 98% mana
3.2/5: 64% soul_shard
2:41.657 aoe I rain_of_fire Fluffy_Pillow 49243.0/50000: 98% mana
3.5/5: 70% soul_shard
2:42.963 aoe J conflagrate Fluffy_Pillow 49896.0/50000: 100% mana
0.6/5: 12% soul_shard
2:44.270 aoe H havoc enemy2 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
backdraft
2:45.577 havoc Q incinerate Fluffy_Pillow 49653.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
2:46.795 havoc P chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.0/5: 40% soul_shard
2:49.405 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:51.147 havoc M conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.3/5: 26% soul_shard
2:52.452 havoc O immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:53.760 havoc P chaos_bolt Fluffy_Pillow 49059.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:55.587 aoe E channel_demonfire Fluffy_Pillow 49973.0/50000: 100% mana
0.8/5: 16% soul_shard
2:58.411 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
3:00.152 aoe F immolate enemy3 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
3:01.460 aoe J conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
1.8/5: 36% soul_shard
3:02.766 aoe F immolate enemy2 49059.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:04.072 cds L summon_infernal Fluffy_Pillow 48962.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
3:05.379 aoe D rain_of_fire Fluffy_Pillow 48616.0/50000: 97% mana
3.1/5: 62% soul_shard
backdraft
3:06.684 aoe K incinerate Fluffy_Pillow 49268.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
3:07.904 aoe K incinerate Fluffy_Pillow 48878.5/50000: 98% mana
1.1/5: 22% soul_shard
3:09.644 aoe J conflagrate Fluffy_Pillow 48748.5/50000: 97% mana
1.9/5: 38% soul_shard
3:10.951 aoe K incinerate Fluffy_Pillow 48902.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
3:12.170 default A cataclysm Fluffy_Pillow 48511.5/50000: 97% mana
3.6/5: 72% soul_shard
3:13.911 aoe D rain_of_fire Fluffy_Pillow 48882.0/50000: 98% mana
4.1/5: 82% soul_shard
3:15.216 default 9 soul_fire Fluffy_Pillow 49534.5/50000: 99% mana
1.4/5: 28% soul_shard
3:18.693 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.6/5: 72% soul_shard
3:21.497 aoe H havoc enemy2 49654.0/50000: 99% mana
4.5/5: 90% soul_shard
3:22.803 havoc P chaos_bolt Fluffy_Pillow 49307.0/50000: 99% mana
5.0/5: 100% soul_shard
3:25.413 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:26.719 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:28.547 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:29.853 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
3:31.159 havoc P chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.9/5: 98% soul_shard
backdraft
3:32.985 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:34.292 aoe F immolate enemy3 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:35.599 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.6/5: 12% soul_shard
3:36.906 aoe K incinerate Fluffy_Pillow 49406.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
3:38.128 aoe K incinerate Fluffy_Pillow 49003.5/50000: 98% mana
1.6/5: 32% soul_shard
3:39.870 aoe K incinerate Fluffy_Pillow 48874.5/50000: 98% mana
2.0/5: 40% soul_shard
3:41.613 aoe E channel_demonfire Fluffy_Pillow 48746.0/50000: 97% mana
2.4/5: 48% soul_shard
3:44.439 default A cataclysm Fluffy_Pillow 49409.0/50000: 99% mana
2.7/5: 54% soul_shard
3:46.180 aoe I rain_of_fire Fluffy_Pillow 49502.5/50000: 99% mana
3.0/5: 60% soul_shard
3:47.486 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
3:48.794 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
3:50.013 aoe K incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
3:51.752 aoe H havoc enemy2 48871.5/50000: 98% mana
1.5/5: 30% soul_shard
3:53.059 havoc M conflagrate Fluffy_Pillow 48525.0/50000: 97% mana
1.8/5: 36% soul_shard
3:54.365 havoc P chaos_bolt Fluffy_Pillow 48678.0/50000: 97% mana
3.0/5: 60% soul_shard
backdraft
3:56.193 havoc O immolate Fluffy_Pillow 49592.0/50000: 99% mana
1.2/5: 24% soul_shard
3:57.501 havoc Q incinerate Fluffy_Pillow 49253.0/50000: 99% mana
1.3/5: 26% soul_shard
3:59.240 havoc P chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.0/5: 40% soul_shard
4:01.849 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
4:03.589 default 9 soul_fire Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
4:07.167 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
4:10.010 aoe F immolate enemy3 49674.0/50000: 99% mana
2.8/5: 56% soul_shard
4:11.318 aoe F immolate enemy2 49253.0/50000: 99% mana
3.0/5: 60% soul_shard
4:12.625 aoe I rain_of_fire Fluffy_Pillow 49156.5/50000: 98% mana
3.0/5: 60% soul_shard
4:13.931 aoe J conflagrate Fluffy_Pillow 49809.5/50000: 100% mana
0.2/5: 4% soul_shard
4:15.236 aoe K incinerate Fluffy_Pillow 49962.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
4:16.455 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
4:18.194 aoe J conflagrate Fluffy_Pillow 49371.5/50000: 99% mana
1.4/5: 28% soul_shard
4:19.501 aoe K incinerate Fluffy_Pillow 49525.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
4:20.722 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
2.4/5: 48% soul_shard
4:22.028 aoe H havoc enemy2 49156.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
4:23.335 havoc P chaos_bolt Fluffy_Pillow 48809.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
4:25.161 havoc Q incinerate Fluffy_Pillow 49722.5/50000: 99% mana
1.4/5: 28% soul_shard
4:26.901 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
4:28.206 havoc O immolate Fluffy_Pillow 49154.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
4:29.511 havoc P chaos_bolt Fluffy_Pillow 49057.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
4:31.337 havoc Q incinerate Fluffy_Pillow 49970.0/50000: 100% mana
1.5/5: 30% soul_shard
4:33.077 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
4:35.890 aoe J conflagrate Fluffy_Pillow 49658.5/50000: 99% mana
2.4/5: 48% soul_shard
4:37.196 aoe F immolate enemy3 49811.5/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
4:38.502 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
4:39.807 aoe K incinerate Fluffy_Pillow 49904.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
4:41.027 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
4:42.768 aoe K incinerate Fluffy_Pillow 48873.0/50000: 98% mana
1.3/5: 26% soul_shard
4:44.508 aoe F immolate enemy2 48743.0/50000: 97% mana
1.6/5: 32% soul_shard
4:45.814 aoe F immolate Fluffy_Pillow 48646.0/50000: 97% mana
1.8/5: 36% soul_shard
4:47.120 aoe J conflagrate Fluffy_Pillow 48549.0/50000: 97% mana
1.9/5: 38% soul_shard
4:48.428 default A cataclysm Fluffy_Pillow 48703.0/50000: 97% mana
2.6/5: 52% soul_shard
backdraft
4:50.169 aoe K incinerate Fluffy_Pillow 49073.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
4:51.388 aoe I rain_of_fire Fluffy_Pillow 48683.0/50000: 97% mana
3.1/5: 62% soul_shard
4:52.695 default 9 soul_fire Fluffy_Pillow 49336.5/50000: 99% mana
0.2/5: 4% soul_shard
4:56.174 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
1.8/5: 36% soul_shard
4:59.027 aoe H havoc enemy2 49679.5/50000: 99% mana
2.2/5: 44% soul_shard
5:00.334 havoc M conflagrate Fluffy_Pillow 49333.0/50000: 99% mana
2.3/5: 46% soul_shard
5:01.642 havoc P chaos_bolt Fluffy_Pillow 49487.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
5:03.472 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
5:04.779 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
5:06.606 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
5:08.347 havoc O immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
5:09.653 havoc M conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
2.0/5: 40% soul_shard
5:10.960 aoe F immolate enemy3 49059.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
5:12.266 aoe I rain_of_fire Fluffy_Pillow 48962.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
5:13.572 aoe K incinerate Fluffy_Pillow 49615.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
5:14.792 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
5:16.533 aoe K incinerate Fluffy_Pillow 48873.0/50000: 98% mana
1.4/5: 28% soul_shard
5:18.274 aoe E channel_demonfire Fluffy_Pillow 48743.5/50000: 97% mana
1.7/5: 34% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="destruction"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Simulation & Raid Information

Iterations: 640
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.4 )

Performance:

Total Events Processed: 12220688
Max Event Queue: 256
Sim Seconds: 192271
CPU Seconds: 19.9844
Physical Seconds: 1.4031
Speed Up: 9621

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Pelagos Kyrian_Pelagos cataclysm 152108 235120 783 5.83 6773 13533 9.7 29.2 19.0% 0.0% 0.0% 0.0% 32.36sec 235120 300.42sec
Kyrian_Pelagos Kyrian_Pelagos channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 26.03sec 0 300.42sec
Kyrian_Pelagos Kyrian_Pelagos channel_demonfire_tick 196448 312055 1039 107.09 487 975 0.0 536.2 19.3% 0.0% 0.0% 0.0% 0.00sec 312055 300.42sec
Kyrian_Pelagos Kyrian_Pelagos chaos_bolt 116858 351672 1171 7.43 0 9461 18.7 37.2 100.0% 0.0% 0.0% 0.0% 15.62sec 351672 300.42sec
Kyrian_Pelagos Kyrian_Pelagos internal_combustion 266134 115758 385 7.23 2678 5358 36.2 36.2 19.5% 0.0% 0.0% 0.0% 15.66sec 115758 300.42sec
Kyrian_Pelagos Kyrian_Pelagos conflagrate 17962 247080 822 10.98 3758 7564 36.9 55.0 19.4% 0.0% 0.0% 0.0% 7.97sec 247080 300.42sec
Kyrian_Pelagos Kyrian_Pelagos havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.16sec 0 300.42sec
Kyrian_Pelagos Kyrian_Pelagos immolate 348 60043 200 6.32 1595 3166 25.4 31.6 19.3% 0.0% 0.0% 0.0% 11.47sec 494854 300.42sec
Kyrian_Pelagos Kyrian_Pelagos immolate ticks -348 434811 1449 69.44 1051 2101 25.4 347.2 19.2% 0.0% 0.0% 0.0% 11.47sec 494854 300.42sec
Kyrian_Pelagos Kyrian_Pelagos incinerate 29722 172396 574 10.07 2877 5720 39.5 50.4 19.0% 0.0% 0.0% 0.0% 7.08sec 172396 300.42sec
Kyrian_Pelagos Kyrian_Pelagos rain_of_fire ticks -5740 301666 1006 0.00 572 1145 18.6 0.0 19.3% 0.0% 0.0% 0.0% 15.46sec 301666 300.42sec
Kyrian_Pelagos Kyrian_Pelagos scouring_tithe 312321 33238 111 3.76 1482 2975 13.5 18.9 18.9% 0.0% 0.0% 0.0% 22.72sec 99163 300.42sec
Kyrian_Pelagos Kyrian_Pelagos scouring_tithe ticks -312321 65925 220 26.73 413 826 13.5 133.7 19.4% 0.0% 0.0% 0.0% 22.72sec 99163 300.42sec
Kyrian_Pelagos Kyrian_Pelagos soul_fire 6353 148133 493 1.49 16490 33010 5.6 7.5 20.4% 0.0% 0.0% 0.0% 49.50sec 148133 300.42sec
Kyrian_Pelagos Kyrian_Pelagos summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Kyrian_Pelagos Kyrian_Pelagos summon_infernal 1122 23952 80 1.20 3348 6696 2.0 6.0 19.2% 0.0% 0.0% 0.0% 180.51sec 23952 300.42sec
Kyrian_Pelagos Kyrian_Pelagos_infernal immolation 20153 194852 3247 117.00 1395 2790 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.49sec 194852 60.00sec
Kyrian_Pelagos Kyrian_Pelagos_infernal melee 0 15937 266 41.00 326 651 41.0 41.0 19.4% 0.0% 0.0% 0.0% 5.25sec 22764 60.00sec
Kyrian_Pelagos Kyrian_Pelagos_imp firebolt 3110 154312 514 18.52 1395 2790 93.4 92.7 19.3% 0.0% 0.0% 0.0% 3.22sec 154312 300.42sec
Necrolord_Emeni Necrolord_Emeni cataclysm 152108 236404 787 5.80 6817 13642 9.7 29.0 19.4% 0.0% 0.0% 0.0% 32.51sec 236404 300.42sec
Necrolord_Emeni Necrolord_Emeni channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.79sec 0 300.42sec
Necrolord_Emeni Necrolord_Emeni channel_demonfire_tick 196448 313392 1043 108.48 484 964 0.0 543.2 19.4% 0.0% 0.0% 0.0% 0.00sec 313392 300.42sec
Necrolord_Emeni Necrolord_Emeni chaos_bolt 116858 360040 1198 7.60 0 9456 19.2 38.1 100.0% 0.0% 0.0% 0.0% 15.09sec 360040 300.42sec
Necrolord_Emeni Necrolord_Emeni internal_combustion 266134 118263 394 7.44 2653 5331 37.3 37.3 19.5% 0.0% 0.0% 0.0% 15.17sec 118263 300.42sec
Necrolord_Emeni Necrolord_Emeni conflagrate 17962 247828 825 11.05 3747 7478 36.8 55.3 19.6% 0.0% 0.0% 0.0% 7.97sec 247828 300.42sec
Necrolord_Emeni Necrolord_Emeni decimating_bolt 325289 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 49.23sec 0 300.42sec
Necrolord_Emeni Necrolord_Emeni decimating_bolt_tick_t 327059 56590 188 7.83 1212 2420 0.0 39.2 19.0% 0.0% 0.0% 0.0% 0.00sec 56590 300.42sec
Necrolord_Emeni Necrolord_Emeni havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.21sec 0 300.42sec
Necrolord_Emeni Necrolord_Emeni immolate 348 59848 199 6.47 1544 3111 26.0 32.4 19.3% 0.0% 0.0% 0.0% 10.89sec 493433 300.42sec
Necrolord_Emeni Necrolord_Emeni immolate ticks -348 433586 1445 69.86 1042 2081 26.0 349.3 19.2% 0.0% 0.0% 0.0% 10.89sec 493433 300.42sec
Necrolord_Emeni Necrolord_Emeni incinerate 29722 280615 934 10.85 4342 8664 43.4 54.3 19.1% 0.0% 0.0% 0.0% 6.47sec 280615 300.42sec
Necrolord_Emeni Necrolord_Emeni rain_of_fire ticks -5740 296753 989 0.00 564 1129 18.6 0.0 19.2% 0.0% 0.0% 0.0% 15.82sec 296753 300.42sec
Necrolord_Emeni Necrolord_Emeni soul_fire 6353 151160 503 1.58 15962 31621 5.6 7.9 20.1% 0.0% 0.0% 0.0% 49.47sec 151160 300.42sec
Necrolord_Emeni Necrolord_Emeni summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Necrolord_Emeni Necrolord_Emeni summon_infernal 1122 23786 79 1.20 3348 6696 2.0 6.0 18.4% 0.0% 0.0% 0.0% 180.42sec 23786 300.42sec
Necrolord_Emeni Necrolord_Emeni_infernal immolation 20153 202749 3379 117.00 1450 2901 39.0 117.0 19.5% 0.0% 0.0% 0.0% 5.49sec 202749 60.00sec
Necrolord_Emeni Necrolord_Emeni_infernal melee 0 16522 275 41.00 338 675 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.25sec 23600 60.00sec
Necrolord_Emeni Necrolord_Emeni_imp firebolt 3110 157664 525 18.52 1426 2854 93.4 92.7 19.2% 0.0% 0.0% 0.0% 3.22sec 157664 300.42sec
NightFae_Dream NightFae_Dream cataclysm 152108 232504 774 5.82 6700 13400 9.7 29.1 19.1% 0.0% 0.0% 0.0% 32.37sec 232504 300.42sec
NightFae_Dream NightFae_Dream channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.45sec 0 300.42sec
NightFae_Dream NightFae_Dream channel_demonfire_tick 196448 307077 1022 107.95 476 953 0.0 540.5 19.4% 0.0% 0.0% 0.0% 0.00sec 307077 300.42sec
NightFae_Dream NightFae_Dream chaos_bolt 116858 390367 1299 8.63 0 9031 21.7 43.2 100.0% 0.0% 0.0% 0.0% 13.51sec 390367 300.42sec
NightFae_Dream NightFae_Dream internal_combustion 266134 134204 447 8.56 2622 5277 42.9 42.9 19.2% 0.0% 0.0% 0.0% 13.49sec 134204 300.42sec
NightFae_Dream NightFae_Dream conflagrate 17962 242370 807 11.32 3584 7186 37.0 56.7 19.2% 0.0% 0.0% 0.0% 7.97sec 242370 300.42sec
NightFae_Dream NightFae_Dream havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.06sec 0 300.42sec
NightFae_Dream NightFae_Dream immolate 348 61940 206 6.79 1528 3052 26.7 34.0 19.3% 0.0% 0.0% 0.0% 10.85sec 483376 300.42sec
NightFae_Dream NightFae_Dream immolate ticks -348 421436 1405 69.57 1014 2030 26.7 347.9 19.4% 0.0% 0.0% 0.0% 10.85sec 483376 300.42sec
NightFae_Dream NightFae_Dream incinerate 29722 184637 615 11.04 2795 5601 44.7 55.3 19.4% 0.0% 0.0% 0.0% 6.13sec 184637 300.42sec
NightFae_Dream NightFae_Dream rain_of_fire ticks -5740 272894 910 0.00 553 1106 17.4 0.0 19.3% 0.0% 0.0% 0.0% 16.45sec 272894 300.42sec
NightFae_Dream NightFae_Dream soul_fire 6353 153602 511 1.57 16423 33102 5.6 7.9 18.6% 0.0% 0.0% 0.0% 49.41sec 153602 300.42sec
NightFae_Dream NightFae_Dream soul_rot ticks -325640 101817 339 19.34 883 1766 5.3 96.7 19.3% 0.0% 0.0% 0.0% 62.53sec 101817 300.42sec
NightFae_Dream NightFae_Dream summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
NightFae_Dream NightFae_Dream summon_infernal 1122 23914 80 1.20 3348 6696 2.0 6.0 19.0% 0.0% 0.0% 0.0% 180.67sec 23914 300.42sec
NightFae_Dream NightFae_Dream_infernal immolation 20153 213592 3560 117.00 1530 3056 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.50sec 213592 60.00sec
NightFae_Dream NightFae_Dream_infernal melee 0 15936 266 41.00 326 651 41.0 41.0 19.4% 0.0% 0.0% 0.0% 5.25sec 22764 60.00sec
NightFae_Dream NightFae_Dream_imp firebolt 3110 154290 514 18.52 1395 2790 93.4 92.7 19.3% 0.0% 0.0% 0.0% 3.22sec 154290 300.42sec
NightFae_Dream_SB NightFae_Dream_SB cataclysm 152108 235572 784 5.81 6805 13610 9.7 29.1 18.9% 0.0% 0.0% 0.0% 32.34sec 235572 300.42sec
NightFae_Dream_SB NightFae_Dream_SB channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.74sec 0 300.42sec
NightFae_Dream_SB NightFae_Dream_SB channel_demonfire_tick 196448 311192 1036 107.80 483 966 0.0 539.8 19.3% 0.0% 0.0% 0.0% 0.00sec 311192 300.42sec
NightFae_Dream_SB NightFae_Dream_SB chaos_bolt 116858 394384 1313 8.60 0 9163 21.6 43.0 100.0% 0.0% 0.0% 0.0% 13.53sec 394384 300.42sec
NightFae_Dream_SB NightFae_Dream_SB internal_combustion 266134 136002 453 8.52 2682 5364 42.6 42.6 18.9% 0.0% 0.0% 0.0% 13.55sec 136002 300.42sec
NightFae_Dream_SB NightFae_Dream_SB conflagrate 17962 245539 817 11.32 3632 7294 37.0 56.7 19.1% 0.0% 0.0% 0.0% 7.97sec 245539 300.42sec
NightFae_Dream_SB NightFae_Dream_SB havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.01sec 0 300.42sec
NightFae_Dream_SB NightFae_Dream_SB immolate 348 62697 209 6.75 1553 3102 26.6 33.8 19.4% 0.0% 0.0% 0.0% 10.89sec 489073 300.42sec
NightFae_Dream_SB NightFae_Dream_SB immolate ticks -348 426376 1421 69.53 1028 2054 26.6 347.7 19.3% 0.0% 0.0% 0.0% 10.89sec 489073 300.42sec
NightFae_Dream_SB NightFae_Dream_SB incinerate 29722 187528 624 11.13 2826 5664 44.9 55.7 19.0% 0.0% 0.0% 0.0% 6.07sec 187528 300.42sec
NightFae_Dream_SB NightFae_Dream_SB rain_of_fire ticks -5740 278053 927 0.00 561 1121 17.5 0.0 19.2% 0.0% 0.0% 0.0% 16.22sec 278053 300.42sec
NightFae_Dream_SB NightFae_Dream_SB soul_fire 6353 156091 520 1.57 16629 32975 5.6 7.9 19.6% 0.0% 0.0% 0.0% 49.51sec 156091 300.42sec
NightFae_Dream_SB NightFae_Dream_SB soul_rot ticks -325640 102826 343 19.32 895 1785 5.3 96.6 19.1% 0.0% 0.0% 0.0% 62.42sec 102826 300.42sec
NightFae_Dream_SB NightFae_Dream_SB summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
NightFae_Dream_SB NightFae_Dream_SB summon_infernal 1122 24155 80 1.20 3379 6755 2.0 6.0 19.2% 0.0% 0.0% 0.0% 180.52sec 24155 300.42sec
NightFae_Dream_SB NightFae_Dream_SB_infernal immolation 20153 197158 3286 117.00 1414 2828 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.49sec 197158 60.00sec
NightFae_Dream_SB NightFae_Dream_SB_infernal melee 0 16149 269 41.00 330 660 41.0 41.0 19.4% 0.0% 0.0% 0.0% 5.25sec 23067 60.00sec
NightFae_Dream_SB NightFae_Dream_SB_imp firebolt 3110 156143 520 18.52 1414 2828 93.4 92.7 19.1% 0.0% 0.0% 0.0% 3.22sec 156143 300.42sec
NightFae_Niya NightFae_Niya cataclysm 152108 238980 795 5.81 6887 13768 9.7 29.1 19.2% 0.0% 0.0% 0.0% 32.38sec 238980 300.42sec
NightFae_Niya NightFae_Niya channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.55sec 0 300.42sec
NightFae_Niya NightFae_Niya channel_demonfire_tick 196448 319231 1063 107.88 496 990 0.0 540.1 19.3% 0.0% 0.0% 0.0% 0.00sec 319231 300.42sec
NightFae_Niya NightFae_Niya chaos_bolt 116858 408098 1358 8.63 0 9442 21.7 43.2 100.0% 0.0% 0.0% 0.0% 13.50sec 408098 300.42sec
NightFae_Niya NightFae_Niya internal_combustion 266134 140384 467 8.56 2744 5512 42.9 42.9 19.2% 0.0% 0.0% 0.0% 13.53sec 140384 300.42sec
NightFae_Niya NightFae_Niya conflagrate 17962 252095 839 11.30 3745 7462 37.0 56.6 19.1% 0.0% 0.0% 0.0% 7.96sec 252095 300.42sec
NightFae_Niya NightFae_Niya havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.03sec 0 300.42sec
NightFae_Niya NightFae_Niya immolate 348 65076 217 6.79 1595 3200 26.8 34.0 19.9% 0.0% 0.0% 0.0% 10.87sec 503465 300.42sec
NightFae_Niya NightFae_Niya immolate ticks -348 438389 1461 69.59 1056 2113 26.8 347.9 19.3% 0.0% 0.0% 0.0% 10.87sec 503465 300.42sec
NightFae_Niya NightFae_Niya incinerate 29722 191425 637 11.08 2899 5822 44.7 55.5 18.9% 0.0% 0.0% 0.0% 6.10sec 191425 300.42sec
NightFae_Niya NightFae_Niya rain_of_fire ticks -5740 285035 950 0.00 576 1153 17.5 0.0 19.3% 0.0% 0.0% 0.0% 16.46sec 285035 300.42sec
NightFae_Niya NightFae_Niya soul_fire 6353 157095 523 1.57 16861 33674 5.6 7.8 18.9% 0.0% 0.0% 0.0% 49.39sec 157095 300.42sec
NightFae_Niya NightFae_Niya soul_rot ticks -325640 101810 339 19.32 882 1768 5.3 96.6 19.4% 0.0% 0.0% 0.0% 62.42sec 101810 300.42sec
NightFae_Niya NightFae_Niya summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
NightFae_Niya NightFae_Niya summon_infernal 1122 23877 79 1.20 3348 6696 2.0 6.0 18.9% 0.0% 0.0% 0.0% 180.72sec 23877 300.42sec
NightFae_Niya NightFae_Niya_infernal immolation 20153 194501 3242 117.00 1395 2790 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.50sec 194501 60.00sec
NightFae_Niya NightFae_Niya_infernal melee 0 15910 265 41.00 326 651 41.0 41.0 19.2% 0.0% 0.0% 0.0% 5.26sec 22726 60.00sec
NightFae_Niya NightFae_Niya_imp firebolt 3110 153881 512 18.52 1395 2790 93.4 92.7 19.0% 0.0% 0.0% 0.0% 3.22sec 153881 300.42sec
Venthyr_Nadjia Venthyr_Nadjia cataclysm 152108 232587 774 5.83 6698 13408 9.7 29.2 18.9% 0.0% 0.0% 0.0% 32.29sec 232587 300.42sec
Venthyr_Nadjia Venthyr_Nadjia channel_demonfire 196447 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.91sec 0 300.42sec
Venthyr_Nadjia Venthyr_Nadjia channel_demonfire_tick 196448 325759 1084 115.85 471 944 0.0 580.1 19.2% 0.0% 0.0% 0.0% 0.00sec 325759 300.42sec
Venthyr_Nadjia Venthyr_Nadjia chaos_bolt 116858 408919 1361 9.04 0 9034 22.8 45.3 100.0% 0.0% 0.0% 0.0% 12.80sec 408919 300.42sec
Venthyr_Nadjia Venthyr_Nadjia internal_combustion 266134 143942 479 8.94 2692 5388 44.8 44.8 19.4% 0.0% 0.0% 0.0% 12.82sec 143942 300.42sec
Venthyr_Nadjia Venthyr_Nadjia conflagrate 17962 245622 818 11.33 3636 7280 37.9 56.7 19.0% 0.0% 0.0% 0.0% 7.80sec 245622 300.42sec
Venthyr_Nadjia Venthyr_Nadjia havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.22sec 0 300.42sec
Venthyr_Nadjia Venthyr_Nadjia immolate 348 65572 218 7.14 1538 3084 28.3 35.7 19.2% 0.0% 0.0% 0.0% 10.09sec 495817 300.42sec
Venthyr_Nadjia Venthyr_Nadjia immolate ticks -348 430245 1434 71.30 1013 2025 28.3 356.5 19.2% 0.0% 0.0% 0.0% 10.09sec 495817 300.42sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 65.23sec 0 300.42sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe_impact 322167 9217 31 2.77 558 1116 0.0 13.9 19.0% 0.0% 0.0% 0.0% 0.00sec 9217 300.42sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe_dot ticks -322170 60250 201 21.25 476 950 0.0 106.3 19.2% 0.0% 0.0% 0.0% 0.00sec 60250 300.42sec
Venthyr_Nadjia Venthyr_Nadjia incinerate 29722 179259 597 10.84 2774 5535 43.2 54.3 19.1% 0.0% 0.0% 0.0% 6.42sec 179259 300.42sec
Venthyr_Nadjia Venthyr_Nadjia rain_of_fire ticks -5740 267406 891 0.00 553 1106 17.1 0.0 19.4% 0.0% 0.0% 0.0% 16.98sec 267406 300.42sec
Venthyr_Nadjia Venthyr_Nadjia soul_fire 6353 154500 514 1.53 16896 33747 5.6 7.7 19.0% 0.0% 0.0% 0.0% 49.65sec 154500 300.42sec
Venthyr_Nadjia Venthyr_Nadjia summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Venthyr_Nadjia Venthyr_Nadjia summon_infernal 1122 24016 80 1.20 3348 6696 2.0 6.0 19.6% 0.0% 0.0% 0.0% 180.72sec 24016 300.42sec
Venthyr_Nadjia Venthyr_Nadjia_infernal immolation 20153 194572 3243 117.00 1395 2790 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.50sec 194572 60.00sec
Venthyr_Nadjia Venthyr_Nadjia_infernal melee 0 15930 265 41.00 326 651 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.26sec 22755 60.00sec
Venthyr_Nadjia Venthyr_Nadjia_imp firebolt 3110 157594 525 18.90 1395 2790 95.3 94.6 19.4% 0.0% 0.0% 0.0% 3.15sec 157594 300.42sec
Venthyr_Theotar Venthyr_Theotar cataclysm 152108 238252 793 5.80 6869 13741 9.7 29.1 19.3% 0.0% 0.0% 0.0% 32.44sec 238252 300.42sec
Venthyr_Theotar Venthyr_Theotar channel_demonfire 196447 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 25.45sec 0 300.42sec
Venthyr_Theotar Venthyr_Theotar channel_demonfire_tick 196448 317890 1058 110.03 484 969 0.0 550.9 19.2% 0.0% 0.0% 0.0% 0.00sec 317890 300.42sec
Venthyr_Theotar Venthyr_Theotar chaos_bolt 116858 417071 1388 8.99 0 9268 22.6 45.0 100.0% 0.0% 0.0% 0.0% 13.00sec 417071 300.42sec
Venthyr_Theotar Venthyr_Theotar internal_combustion 266134 143910 479 8.91 2702 5398 44.6 44.6 19.4% 0.0% 0.0% 0.0% 12.99sec 143910 300.42sec
Venthyr_Theotar Venthyr_Theotar conflagrate 17962 247973 825 11.15 3716 7485 37.1 55.8 19.3% 0.0% 0.0% 0.0% 7.97sec 247973 300.42sec
Venthyr_Theotar Venthyr_Theotar havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.24sec 0 300.42sec
Venthyr_Theotar Venthyr_Theotar immolate 348 65948 220 7.02 1580 3165 28.1 35.1 18.7% 0.0% 0.0% 0.0% 10.41sec 496614 300.42sec
Venthyr_Theotar Venthyr_Theotar immolate ticks -348 430666 1436 69.35 1041 2082 28.1 346.8 19.3% 0.0% 0.0% 0.0% 10.41sec 496614 300.42sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.93sec 0 300.42sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe_impact 322167 9312 31 2.79 558 1116 0.0 14.0 19.6% 0.0% 0.0% 0.0% 0.00sec 9312 300.42sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe_dot ticks -322170 58630 195 20.34 484 967 0.0 101.7 19.2% 0.0% 0.0% 0.0% 0.00sec 58630 300.42sec
Venthyr_Theotar Venthyr_Theotar incinerate 29722 178708 595 10.53 2848 5654 41.8 52.7 19.3% 0.0% 0.0% 0.0% 6.50sec 178708 300.42sec
Venthyr_Theotar Venthyr_Theotar rain_of_fire ticks -5740 264566 882 0.00 569 1139 16.4 0.0 19.3% 0.0% 0.0% 0.0% 17.53sec 264566 300.42sec
Venthyr_Theotar Venthyr_Theotar soul_fire 6353 155596 518 1.51 17123 34444 5.6 7.6 19.7% 0.0% 0.0% 0.0% 49.45sec 155596 300.42sec
Venthyr_Theotar Venthyr_Theotar summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
Venthyr_Theotar Venthyr_Theotar summon_infernal 1122 24269 81 1.20 3348 6696 2.0 6.0 20.8% 0.0% 0.0% 0.0% 180.63sec 24269 300.42sec
Venthyr_Theotar Venthyr_Theotar_infernal immolation 20153 194291 3238 117.00 1395 2790 39.0 117.0 19.0% 0.0% 0.0% 0.0% 5.49sec 194291 60.00sec
Venthyr_Theotar Venthyr_Theotar_infernal melee 0 16004 267 41.00 326 651 41.0 41.0 19.9% 0.0% 0.0% 0.0% 5.25sec 22860 60.00sec
Venthyr_Theotar Venthyr_Theotar_imp firebolt 3110 154422 514 18.52 1395 2790 93.4 92.7 19.4% 0.0% 0.0% 0.0% 3.22sec 154422 300.42sec
destruction destruction cataclysm 152108 231308 770 5.79 6699 13401 9.7 29.0 19.0% 0.0% 0.0% 0.0% 32.45sec 231308 300.42sec
destruction destruction channel_demonfire 196447 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 25.32sec 0 300.42sec
destruction destruction channel_demonfire_tick 196448 309812 1031 110.32 470 941 0.0 552.4 19.2% 0.0% 0.0% 0.0% 0.00sec 309812 300.42sec
destruction destruction chaos_bolt 116858 375673 1250 8.80 0 8523 22.2 44.1 100.0% 0.0% 0.0% 0.0% 13.30sec 375673 300.42sec
destruction destruction internal_combustion 266134 136046 453 8.70 2634 5238 43.5 43.5 18.9% 0.0% 0.0% 0.0% 13.29sec 136046 300.42sec
destruction destruction conflagrate 17962 240628 801 11.21 3596 7229 37.1 56.1 19.1% 0.0% 0.0% 0.0% 7.94sec 240628 300.42sec
destruction destruction havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.27sec 0 300.42sec
destruction destruction immolate 348 64147 214 7.01 1535 3067 28.0 35.1 19.2% 0.0% 0.0% 0.0% 10.40sec 483793 300.42sec
destruction destruction immolate ticks -348 419646 1399 69.46 1014 2026 28.0 347.3 19.2% 0.0% 0.0% 0.0% 10.40sec 483793 300.42sec
destruction destruction incinerate 29722 182717 608 11.64 2632 5267 46.9 58.3 19.1% 0.0% 0.0% 0.0% 5.85sec 182717 300.42sec
destruction destruction rain_of_fire ticks -5740 266342 888 0.00 553 1105 17.1 0.0 19.2% 0.0% 0.0% 0.0% 16.87sec 266342 300.42sec
destruction destruction soul_fire 6353 152403 507 1.51 16958 34005 5.6 7.6 18.7% 0.0% 0.0% 0.0% 49.60sec 152403 300.42sec
destruction destruction summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.42sec
destruction destruction summon_infernal 1122 23957 80 1.20 3348 6696 2.0 6.0 19.3% 0.0% 0.0% 0.0% 180.52sec 23957 300.42sec
destruction destruction_infernal immolation 20153 194514 3242 117.00 1395 2790 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.49sec 194514 60.00sec
destruction destruction_infernal melee 0 15922 265 41.00 326 651 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.25sec 22743 60.00sec
destruction destruction_imp firebolt 3110 154650 515 18.52 1395 2790 93.4 92.7 19.6% 0.0% 0.0% 0.0% 3.22sec 154650 300.42sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
39031.1 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 55.9sec 13.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 146.8s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.22%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.6sec 8.79% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 42.5s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.80%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 29.6sec 9.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.6s / 44.0s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.90%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 30.2sec 10.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.0s / 39.6s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.18%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.1sec 11.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.2s / 39.7s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.16%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 33.7sec 11.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.1s / 41.1s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.38%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.0sec 11.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.5s / 43.3s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.46%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.2sec 10.53% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.6s / 44.3s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.53%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 22.6sec 7.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.5s / 32.4s

Stack Uptimes

  • Health Decade (80 - 90)_1:7.64%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 24.5sec 5.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.7s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.87%
infernal: Infernal Brand 2.0 39.0 176.3sec 5.3sec 37.5sec 25.26% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 185.0s
  • trigger_min/max:1.3s / 155.6s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.04%
  • infernal_brand_2:1.04%
  • infernal_brand_3:1.04%
  • infernal_brand_4:1.04%
  • infernal_brand_5:1.04%
  • infernal_brand_6:1.04%
  • infernal_brand_7:1.04%
  • infernal_brand_8:1.04%
  • infernal_brand_9:1.04%
  • infernal_brand_10:1.04%
  • infernal_brand_11:1.04%
  • infernal_brand_12:1.04%
  • infernal_brand_13:1.04%
  • infernal_brand_14:1.04%
  • infernal_brand_15:10.76%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Conflagrate (roaring_blaze) 19.1 18.0 15.6sec 8.0sec 12.6sec 80.20% 0.00% 18.0 (18.0) 18.4

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 41.1s
  • trigger_min/max:2.0s / 23.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.0s

Stack Uptimes

  • roaring_blaze_1:80.20%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.4 17.6 15.4sec 8.0sec 12.3sec 79.30% 0.00% 17.6 (17.6) 18.6

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.6s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.0s

Stack Uptimes

  • roaring_blaze_1:79.30%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.4 17.6 15.3sec 8.0sec 12.3sec 79.65% 0.00% 17.6 (17.6) 18.6

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.8s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.1s

Stack Uptimes

  • roaring_blaze_1:79.65%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.2 17.8 15.5sec 8.0sec 12.4sec 79.42% 0.00% 17.8 (17.8) 18.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 47.6s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.6s

Stack Uptimes

  • roaring_blaze_1:79.42%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.7 18.4 16.0sec 8.0sec 12.9sec 79.97% 0.00% 18.4 (18.4) 17.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 51.7s
  • trigger_min/max:1.9s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.0s

Stack Uptimes

  • roaring_blaze_1:79.97%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.8 20.1 16.9sec 7.8sec 13.7sec 81.37% 0.00% 20.1 (20.1) 17.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 47.5s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.7s

Stack Uptimes

  • roaring_blaze_1:81.37%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.2 18.7 16.3sec 8.0sec 12.9sec 78.36% 0.00% 18.7 (18.7) 17.4

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.4s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.5s

Stack Uptimes

  • roaring_blaze_1:78.36%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.9 18.0 15.8sec 8.0sec 12.5sec 78.40% 0.00% 18.0 (18.0) 18.1

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 47.7s
  • trigger_min/max:1.9s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.0s

Stack Uptimes

  • roaring_blaze_1:78.40%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Fluffy_Pillow Damage Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 624
Mean 41798.85
Minimum 40326.73
Maximum 43535.21
Spread ( max - min ) 3208.48
Range [ ( max - min ) / 2 * 100% ] 3.84%
Standard Deviation 658.4453
5th Percentile 40829.78
95th Percentile 42909.10
( 95th Percentile - 5th Percentile ) 2079.32
Mean Distribution
Standard Deviation 26.3589
95.00% Confidence Interval ( 41747.19 - 41850.52 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 954
0.1 Scale Factor Error with Delta=300 3702
0.05 Scale Factor Error with Delta=300 14805
0.01 Scale Factor Error with Delta=300 370104
HPS
Fluffy_Pillow Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 43
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 13426212 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
20820.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 57.8sec 13.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 150.9s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.77%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 29.4sec 8.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.8s / 46.6s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.93%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 29.6sec 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.5s / 48.9s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.93%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 29.7sec 10.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.5s / 35.7s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.01%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.7s / 42.0s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.67%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 36.6sec 12.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.7s / 50.0s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.34%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.8sec 11.73% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.6s / 49.2s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.73%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 29.5sec 9.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.4s / 39.1s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.96%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 18.6sec 6.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.3s / 27.0s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.28%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 23.6sec 5.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.4s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.57%
Havoc 9.6 0.0 32.3sec 32.3sec 11.8sec 37.83% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.83%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.0sec 32.0sec 11.8sec 37.99% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 40.5s
  • trigger_min/max:30.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.99%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 31.9sec 32.0sec 11.8sec 38.00% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 40.0s
  • trigger_min/max:30.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:38.00%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.0sec 32.0sec 11.8sec 38.01% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 39.5s
  • trigger_min/max:30.0s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:38.01%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.3sec 11.8sec 37.90% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.90%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.2sec 32.2sec 11.8sec 37.89% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.5s
  • trigger_min/max:30.0s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.89%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.1sec 32.2sec 11.8sec 37.98% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.98%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.1sec 32.2sec 11.8sec 37.93% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.4s
  • trigger_min/max:30.0s / 39.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.93%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Conflagrate (roaring_blaze) 10.4 8.6 29.4sec 15.5sec 11.4sec 39.50% 0.00% 8.6 (8.6) 10.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 67.7s
  • trigger_min/max:2.4s / 67.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.2s

Stack Uptimes

  • roaring_blaze_1:39.50%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.1 28.9sec 14.9sec 11.7sec 41.01% 0.00% 9.1 (9.1) 10.2

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 41.9s
  • trigger_min/max:2.4s / 41.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.01%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.6 9.1 28.8sec 14.9sec 11.7sec 41.16% 0.00% 9.1 (9.1) 10.2

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:2.4s / 41.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.16%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.6 9.1 28.7sec 14.9sec 11.6sec 41.13% 0.00% 9.1 (9.1) 10.2

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 41.9s
  • trigger_min/max:2.4s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.13%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.3 8.4 29.6sec 15.8sec 11.3sec 39.04% 0.00% 8.4 (8.4) 10.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.1s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.04%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.8 8.1 28.4sec 15.7sec 11.0sec 39.58% 0.00% 8.1 (8.1) 10.4

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 65.0s
  • trigger_min/max:2.4s / 61.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.58%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.1 6.9 27.1sec 16.3sec 10.7sec 39.76% 0.00% 6.9 (6.9) 10.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 66.3s
  • trigger_min/max:2.4s / 66.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.76%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 12.0 6.5 24.9sec 15.9sec 10.4sec 41.83% 0.00% 6.5 (6.5) 11.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 66.9s
  • trigger_min/max:2.4s / 66.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.3s

Stack Uptimes

  • roaring_blaze_1:41.83%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
enemy2 Damage Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 624
Mean 22269.76
Minimum 21142.56
Maximum 23674.08
Spread ( max - min ) 2531.52
Range [ ( max - min ) / 2 * 100% ] 5.68%
Standard Deviation 497.8051
5th Percentile 21509.56
95th Percentile 23151.86
( 95th Percentile - 5th Percentile ) 1642.31
Mean Distribution
Standard Deviation 19.9282
95.00% Confidence Interval ( 22230.70 - 22308.82 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1920
0.1 Scale Factor Error with Delta=300 2116
0.05 Scale Factor Error with Delta=300 8462
0.01 Scale Factor Error with Delta=300 211545
HPS
enemy2 Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 43
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 7821584 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
12647.9 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 57.3sec 13.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 152.2s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.73%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 29.2sec 8.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 47.3s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.95%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 28.4sec 9.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:6.2s / 48.8s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.49%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 27.4sec 9.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.4s / 41.8s

Stack Uptimes

  • Health Decade (30 - 40)_1:9.24%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.3sec 11.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.3s / 44.0s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.24%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 38.2sec 12.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 50.4s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.87%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.6sec 12.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.4s / 48.3s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.68%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.8sec 10.71% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 49.0s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.71%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 15.3sec 5.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.3s / 27.0s

Stack Uptimes

  • Health Decade (80 - 90)_1:5.16%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 25.3sec 6.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:6.17%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 624
Mean 300.42
Minimum 240.02
Maximum 359.78
Spread ( max - min ) 119.75
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
enemy3 Damage Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 624
Mean 13467.15
Minimum 12755.43
Maximum 14310.98
Spread ( max - min ) 1555.55
Range [ ( max - min ) / 2 * 100% ] 5.78%
Standard Deviation 325.9221
5th Percentile 12962.68
95th Percentile 14011.05
( 95th Percentile - 5th Percentile ) 1048.37
Mean Distribution
Standard Deviation 13.0473
95.00% Confidence Interval ( 13441.57 - 13492.72 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2250
0.1 Scale Factor Error with Delta=300 907
0.05 Scale Factor Error with Delta=300 3628
0.01 Scale Factor Error with Delta=300 90680
HPS
enemy3 Healing Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 624
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 43
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 3630417 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.